DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and NP3

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_187254.1 Gene:NP3 / 819774 AraportID:AT3G06030 Length:651 Species:Arabidopsis thaliana


Alignment Length:289 Identity:92/289 - (31%)
Similarity:146/289 - (50%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 IGEGSTGTVCIATDKSTGRQVAVKKMDL--------RKQQRRELLFNEVVIMRDYHHPNIVETYS 430
            ||.|:.|.|.:..:..:|..:|:|::.:        :.|.....|..||.::::..|||||....
plant    74 IGCGAFGRVYMGMNLDSGELLAIKQVLIAPSSASKEKTQGHIRELEEEVQLLKNLSHPNIVRYLG 138

  Fly   431 SFLVNDELWVVMEYLEGGALTDIV-THSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSIL 494
            :...:|.|.::||::.||:::.:: ......|..|....||.|..|.|||:.|::|||||..:||
plant   139 TVRESDSLNILMEFVPGGSISSLLEKFGSFPEPVIIMYTKQLLLGLEYLHNNGIMHRDIKGANIL 203

  Fly   495 LAADGRVKLSDFGFCAQVSQ--ELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVD 557
            :...|.::|:|||...:|.:  .:...||:.||||||:||||.:..:....||||:|..||||..
plant   204 VDNKGCIRLADFGASKKVVELATVNGAKSMKGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMAT 268

  Fly   558 GEPPFFNE----------------PPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQ 606
            |:||:..:                ||:          |.:|      ||..:.||.:.|.::|:.
plant   269 GKPPWSEQYQQFAAVLHIGRTKAHPPI----------PEDL------SPEAKDFLMKCLHKEPSL 317

  Fly   607 RATAAELLAHPFLRQAGPPSLLVPLMRNA 635
            |.:|.|||.|||:  .|......|..||:
plant   318 RLSATELLQHPFV--TGKRQEPYPAYRNS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 88/272 (32%)
S_TKc 372..619 CDD:214567 87/271 (32%)
NP3NP_187254.1 STKc_MAPKKK 67..330 CDD:270783 87/271 (32%)
S_TKc 68..330 CDD:214567 87/271 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.