DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and STK3

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_016869245.1 Gene:STK3 / 6788 HGNCID:11406 Length:580 Species:Homo sapiens


Alignment Length:325 Identity:122/325 - (37%)
Similarity:185/325 - (56%) Gaps:18/325 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 GASSAAQQASGASGGAAGQPKQDQRLTHEQFRAALQMVVSAGDPRENLDHFNKIGEGSTGTVCIA 385
            ||:|..::...::.|.  :.|||.:|      ..|........|.|..|...|:||||.|:|..|
Human    73 GAASVFKKKEWSTQGE--ENKQDSKL------KKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKA 129

  Fly   386 TDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDELWVVMEYLEGGAL 450
            ..|.:|:.||:|::.:....:.  :..|:.||:....|.:|:.|.|:..|.:||:||||...|::
Human   130 IHKESGQVVAIKQVPVESDLQE--IIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSV 192

  Fly   451 TDIV--THSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQVS 513
            :||:  .:..:.|::|||:.|..||.|.|||....||||||:.:|||..:|..||:|||...|::
Human   193 SDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLT 257

  Fly   514 QELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQ 578
            ..:.||.:::|||:||:||||..:.|....|||||||..|||.:|:||:.:..|::|:..|....
Human   258 DTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNP 322

  Fly   579 PPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRQAGPPSLLVPLMRNA------RH 637
            ||..:.....|.....|:.:.||::|.|||||.:||.|||::.|.|.|:|..|:..|      ||
Human   323 PPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRH 387

  Fly   638  637
            Human   388  387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 105/261 (40%)
S_TKc 372..619 CDD:214567 101/248 (41%)
STK3XP_016869245.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.