DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and TAOK1

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_065842.1 Gene:TAOK1 / 57551 HGNCID:29259 Length:1001 Species:Homo sapiens


Alignment Length:281 Identity:105/281 - (37%)
Similarity:154/281 - (54%) Gaps:12/281 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 DPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRREL---LFNEVVIMRDYHHPN 424
            ||.:......:||.||.|.|..|.|..|...||:|||....:|..|.   :..||..::...|||
Human    23 DPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKWQDIIKEVKFLQRIKHPN 87

  Fly   425 IVETYSSFLVNDELWVVMEYLEGGALTDIVTHSR-MDEEQIATVCKQCLKALAYLHSQGVIHRDI 488
            .:|....:|.....|:||||..|.|...:..|.: :.|.:||.:....|:.||||||..:|||||
Human    88 SIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHTMIHRDI 152

  Fly   489 KSDSILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRL---PYGPEVDIWSLGI 550
            |:.:|||...|:|||:|||..:..|    ...|.|||||||:||||..:   .|..:||:|||||
Human   153 KAGNILLTEPGQVKLADFGSASMAS----PANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGI 213

  Fly   551 MVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLA 615
            ..||:.:.:||.||...:.|:..|...:.|.|: :::.|...::|:|..|.:.|..|.|:.|||.
Human   214 TCIELAERKPPLFNMNAMSALYHIAQNESPTLQ-SNEWSDYFRNFVDSCLQKIPQDRPTSEELLK 277

  Fly   616 HPFLRQAGPPSLLVPLMRNAR 636
            |.|:.:..|.::|:.|::..:
Human   278 HIFVLRERPETVLIDLIQRTK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 102/263 (39%)
S_TKc 372..619 CDD:214567 99/253 (39%)
TAOK1NP_065842.1 STKc_TAO1 2..318 CDD:270805 105/281 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..433
SbcC <442..>877 CDD:223496
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 567..587
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.