DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and Stk3

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_062609.2 Gene:Stk3 / 56274 MGIID:1928487 Length:497 Species:Mus musculus


Alignment Length:282 Identity:113/282 - (40%)
Similarity:168/282 - (59%) Gaps:10/282 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 PRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVET 428
            |.|..|...|:||||.|:|..|..|.:|:.||:|::.:....:.  :..|:.||:....|.:|:.
Mouse    23 PEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQE--IIKEISIMQQCDSPYVVKY 85

  Fly   429 YSSFLVNDELWVVMEYLEGGALTDIV--THSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSD 491
            |.|:..|.:||:||||...|:::||:  .:..:.|::|||:.|..||.|.|||....||||||:.
Mouse    86 YGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAG 150

  Fly   492 SILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMV 556
            :|||..:|..||:|||...|::..:.||.:::|||:||:||||..:.|....|||||||..|||.
Mouse   151 NILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMA 215

  Fly   557 DGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRQ 621
            :|:||:.:..|::|:..|....||..:.....|.....|:.:.||:.|.|||||.:||.|||::.
Mouse   216 EGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFIKN 280

  Fly   622 AGPPSLLVPLMRNA------RH 637
            |.|.|:|..|:..|      ||
Mouse   281 AKPVSILRDLIAEAMEIKAKRH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 105/257 (41%)
S_TKc 372..619 CDD:214567 101/248 (41%)
Stk3NP_062609.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
STKc_MST1_2 23..278 CDD:132943 104/256 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..343 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..394
Mst1_SARAH 443..490 CDD:371637
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.