DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and fray

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster


Alignment Length:490 Identity:135/490 - (27%)
Similarity:224/490 - (45%) Gaps:122/490 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 QQQQTSPVGSVASGTRSNHSHTNNGNSGGSYPPMYPTSHQQQQQQQQQAKQGGDQNQNP------ 293
            ::||.:|....:.|.|      .:.|||         |::.||.:|:|.::  .:|::|      
  Fly    47 EEQQHNPKKKQSEGPR------ESSNSG---------SYKVQQTEQEQRRE--SENEHPSVYRQQ 94

  Fly   294 ---LHPHAHPHPHHHQHLAK-----------------------------------SASRASSSSG 320
               .||.....|.....::|                                   :||..|.:|.
  Fly    95 DEEFHPIKKEEPQKTPPISKQPRPRNTPRSQSQPAINNRRRPGTPPPHTVAPGNGTASSRSMTSI 159

  Fly   321 GASSAAQQASGAS--GGAAGQPKQDQRLTHEQFRAALQMVVSAGDPRENLDHFNKIGEGST---- 379
            .|:.::...:||:  .|||..|::                .:..:.:::.:..:.||.|:|    
  Fly   160 PANLSSNNVAGAATLPGAAAPPEK----------------YTWPNSKDDYELRDVIGVGATAVVH 208

  Fly   380 GTVCIATDKSTGRQVAVKKMDLRK-QQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDELWVVME 443
            |..||..::    :.|:|:::|.| ....:.|..|:..|....|.|:|..::||:|.:|||:|:.
  Fly   209 GAYCIPRNE----KCAIKRINLEKWNTSMDELLKEIQAMSSCFHENVVTYHTSFVVREELWLVLR 269

  Fly   444 YLEGGALTDIVTHSR---------MDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADG 499
            .||||:|.||:.|..         .||..||||.|:.||.|.|.||.|.||||||:.:||:..||
  Fly   270 LLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVLKGLEYFHSNGQIHRDIKAGNILIGDDG 334

  Fly   500 RVKLSDFGFCAQVS--QELPKRK---SLVGTPYWMSPEVISR-LPYGPEVDIWSLGIMVIEMVDG 558
            .::::|||..|.::  ::|.::|   :.||||.||:|||:.: ..|..:.||||.||..|||..|
  Fly   335 TIQIADFGVSAWLATGRDLSRQKVRHTFVGTPCWMAPEVMEQDHGYDFKADIWSFGITAIEMATG 399

  Fly   559 EPPFFNEPPLQAMRRIRDMQPPNL------KNAHKV-SPRLQSFLDRMLVRDPAQRATAAELLAH 616
            ..|:...||::.:.......||.|      |:.:|. ....:..:...|.::|::|.||:|||.|
  Fly   400 TAPYHKYPPMKVLMLTLQNDPPTLDTGADDKDQYKAYGKTFRKMIVECLQKEPSKRPTASELLKH 464

  Fly   617 PFLRQA------------GPPSLLVPLMRNARHHP 639
            .|.::|            ..||:...:.:.|:..|
  Fly   465 AFFKKAKDRKYLTQTLLQSGPSMETRVHKAAKRQP 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 100/286 (35%)
S_TKc 372..619 CDD:214567 99/273 (36%)
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 99/279 (35%)
OSR1_C 613..670 CDD:403428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.