DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and oxsr1b

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_957469.2 Gene:oxsr1b / 394150 ZFINID:ZDB-GENE-040426-723 Length:520 Species:Danio rerio


Alignment Length:272 Identity:103/272 - (37%)
Similarity:155/272 - (56%) Gaps:23/272 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 IGEGSTGTVCIATDKSTGRQVAVKKMDLRK-QQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDE 437
            ||.|:|..|..|.......:||:|:::|.| |...:.|..|:..|...||||||..|:||:|.||
Zfish    23 IGSGATAVVQAAYCVPRKEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVVKDE 87

  Fly   438 LWVVMEYLEGGALTDIVTH---------SRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSI 493
            ||:||:.|.||::.|::.|         ..:||..||||.|:.|:.|.|||..|.||||:|:.:|
Zfish    88 LWLVMKLLSGGSVLDVIKHIISKGEHKTGVLDEPSIATVLKEVLQGLEYLHKNGQIHRDLKAGNI 152

  Fly   494 LLAADGRVKLSDFGFCAQVSQ--ELPK---RKSLVGTPYWMSPEVISRLP-YGPEVDIWSLGIMV 552
            ||..||.|:::|||..|.::.  ::.:   ||:.||||.||:|||:.::. |..:.||||.||..
Zfish   153 LLGEDGSVQIADFGVSAFLATGGDMTRNKVRKTFVGTPCWMAPEVMEQVKGYDFKADIWSFGITA 217

  Fly   553 IEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKN-------AHKVSPRLQSFLDRMLVRDPAQRATA 610
            ||:..|..|:...||::.:.......||.|:.       ..|....|:..:.:.|.::|.:|.|:
Zfish   218 IELATGAAPYHKYPPMKVLMLTLQNDPPCLETGITDKEMVKKYGKSLRKMISQCLQKEPEKRPTS 282

  Fly   611 AELLAHPFLRQA 622
            :|||.|.|.::|
Zfish   283 SELLKHKFFQKA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 102/268 (38%)
S_TKc 372..619 CDD:214567 101/267 (38%)
oxsr1bNP_957469.2 STKc_OSR1_SPAK 15..291 CDD:270787 101/267 (38%)
S_TKc 17..291 CDD:214567 101/267 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.