DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and Slik

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_726441.1 Gene:Slik / 37893 FlyBaseID:FBgn0035001 Length:1703 Species:Drosophila melanogaster


Alignment Length:266 Identity:100/266 - (37%)
Similarity:151/266 - (56%) Gaps:7/266 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 DPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVE 427
            ||.|..:...::|:|:.|.|..|..|...|..|.|...|..::.......|:.|:.:..||||||
  Fly    32 DPAEFWEMVGELGDGAFGKVYKAQHKEQKRFAAAKMCQLEDEENLSDHMVEIDILSEIKHPNIVE 96

  Fly   428 TYSSFLVNDELWVVMEYLEGGALTDIVT--HSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKS 490
            .|.:|.::|:||:::||.:||||..|:.  ...:.|.|||.|||...:.|.:||...|||||:|:
  Fly    97 LYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVCKHMTEGLTFLHRNKVIHRDLKA 161

  Fly   491 DSILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVI-----SRLPYGPEVDIWSLGI 550
            .::||..:|.|||:|||..|:....:.|..:.:||||||:||::     ...||..:||||||||
  Fly   162 GNVLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGTPYWMAPELVLCETFRDNPYDHKVDIWSLGI 226

  Fly   551 MVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLA 615
            .:||:...|||.....|::.:.:|:..:||.|:...:.|.....||.:.||:||..|.|...|:.
  Fly   227 TLIELAQMEPPNSEMSPMRVLLKIQKSEPPKLEQPSRWSKEFNDFLKKSLVKDPQVRPTTDVLMQ 291

  Fly   616 HPFLRQ 621
            |.|:.:
  Fly   292 HAFINR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 100/263 (38%)
S_TKc 372..619 CDD:214567 96/253 (38%)
SlikNP_726441.1 STKc_SLK_like 31..310 CDD:132942 100/266 (38%)
S_TKc 37..295 CDD:214567 96/257 (37%)
PKK 958..1095 CDD:289257
PKK 1126..1266 CDD:289257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.