DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and Stk25

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_908938.1 Gene:Stk25 / 373542 RGDID:727809 Length:426 Species:Rattus norvegicus


Alignment Length:272 Identity:107/272 - (39%)
Similarity:157/272 - (57%) Gaps:4/272 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 DPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRK-QQRRELLFNEVVIMRDYHHPNIV 426
            ||.|.....::||:||.|.|....|..|...||:|.:||.: :...|.:..|:.::.....|.|.
  Rat    15 DPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYIT 79

  Fly   427 ETYSSFLVNDELWVVMEYLEGGALTDIVTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSD 491
            ..:.|:|.:.:||::||||.||:..|::....::|..|||:.::.||.|.||||:..||||||:.
  Rat    80 RYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAA 144

  Fly   492 SILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMV 556
            ::||:..|.|||:|||...|::....||.:.||||:||:||||.:..|..:.|||||||..||:.
  Rat   145 NVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELA 209

  Fly   557 DGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFL-R 620
            .||||..:..|::.:..|....||.|:..|  |...:.|::..|.:||..|.||.|||.|.|: |
  Rat   210 KGEPPNSDLHPMRVLFLIPKNNPPTLEGHH--SKPFKEFVEACLNKDPRFRPTAKELLKHKFITR 272

  Fly   621 QAGPPSLLVPLM 632
            .....|.|..|:
  Rat   273 YTKKTSFLTELI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 103/258 (40%)
S_TKc 372..619 CDD:214567 99/247 (40%)
Stk25NP_908938.1 STKc_STK25 15..291 CDD:270810 107/272 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.