DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and Stlk

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster


Alignment Length:292 Identity:83/292 - (28%)
Similarity:137/292 - (46%) Gaps:43/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 GSTGTVCIATDKSTGRQVAVKKMDL-RKQQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDELWV 440
            |..|||..|.| ...:.:||||:.: :..::..||||||:.:|...|.||....|.||....:::
  Fly    19 GMIGTVYKAED-INNKCLAVKKVSMDQPMEKLTLLFNEVLTVRRLQHRNINTIVSCFLYKQYVYL 82

  Fly   441 VMEYLEGG----ALTDIVTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRV 501
            ..:::..|    .|.::.| |...|..||.:.|..|.||.|:||:..:|..:::..|||:....|
  Fly    83 TYKFMCFGNCEVLLKNVYT-SGFPEVAIALILKDVLSALTYIHSEHYVHGSVRAKHILLSPRKAV 146

  Fly   502 KLSDFGFCAQVSQELPKRKSLVGTP-------YWMSPEVI--SRLPYGPEVDIWSLGIMVIEMVD 557
             ||:|.:|.....:..|:..:.|:.       ||.:|||:  :...|..::||:|:||...||.:
  Fly   147 -LSNFSYCQSFISQGEKKTFIFGSTVGIEKELYWTAPEVLYQNLSGYTEKIDIYSIGITCCEMAN 210

  Fly   558 GEPPFFN-EPPLQAMRRIR-------------------DMQPPNLKNAHKV------SPRLQSFL 596
            |..||.: |.....:.::|                   .::..|.:.|..|      |.....|:
  Fly   211 GFQPFKDTELTYMYIEKVRGSLQVLLDKNSLLENQGSLSLEHTNKRIARDVIVNKSFSENFHQFV 275

  Fly   597 DRMLVRDPAQRATAAELLAHPFLRQAGPPSLL 628
            :..|.::|..|..|::|:.|.||:|....|||
  Fly   276 ELCLNKNPLSRWAASKLMTHSFLKQCRNTSLL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 78/282 (28%)
S_TKc 372..619 CDD:214567 77/281 (27%)
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 83/292 (28%)
S_TKc 10..298 CDD:214567 77/281 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.