DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and map4k5

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_021336201.1 Gene:map4k5 / 334565 ZFINID:ZDB-GENE-030131-6497 Length:894 Species:Danio rerio


Alignment Length:287 Identity:109/287 - (37%)
Similarity:169/287 - (58%) Gaps:12/287 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 DPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVE 427
            :|:.:.:...::|.|:.|.|..|...|||...|||.:.|.......::..|:.::::..|.|||.
Zfish    15 NPQHDFELIQRVGSGTYGDVYKARKISTGELAAVKIIKLEPGDDFSIIQQEIFMVKECTHHNIVA 79

  Fly   428 TYSSFLVNDELWVVMEYLEGGALTDI--VTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKS 490
            .:.|:|..::||:.|||..||:|.||  || ..:.|.|||.||::.|:.|.||||:|.:|||||.
Zfish    80 YFGSYLCREKLWICMEYCGGGSLQDIYHVT-GPLSELQIAYVCRETLQGLGYLHSKGKMHRDIKG 143

  Fly   491 DSILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVIS---RLPYGPEVDIWSLGIMV 552
            .:|||..:|.|||:|||..|:::..:.||||.:||||||:|||.:   ...|....|||::||..
Zfish   144 ANILLTDNGDVKLADFGVAAKITATMAKRKSFIGTPYWMAPEVAAVEKNGGYNHLCDIWAVGITS 208

  Fly   553 IEMVDGEPPFFNEPPLQAMRRI--RDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLA 615
            ||:.:.:||.|:..|::|:..:  .:.|||.||:..|.|....:|:...|.::|.:|.||.::|:
Zfish   209 IELAELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSTAFHNFVKLSLTKNPKRRPTAEKMLS 273

  Fly   616 HPFLRQAGPPSL----LVPLMRNARHH 638
            |.|:.|.|....    |:..|.|..:|
Zfish   274 HLFVGQTGLTRRLALELLDKMNNPDNH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 103/263 (39%)
S_TKc 372..619 CDD:214567 101/253 (40%)
map4k5XP_021336201.1 STKc_MAP4K5 10..277 CDD:270813 102/262 (39%)
CNH 559..874 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.