DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and Tao

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster


Alignment Length:282 Identity:107/282 - (37%)
Similarity:157/282 - (55%) Gaps:14/282 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 DPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRREL---LFNEVVIMRDYHHPN 424
            ||.:..:...:||.||.|.|..|....|...||:|||....:|.:|.   :..|:..:|..:|||
  Fly    22 DPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPN 86

  Fly   425 IVETYSSFLVNDELWVVMEYLEGGALTDIVTHSR-MDEEQIATVCKQCLKALAYLHSQGVIHRDI 488
            .:|....:|.....|:||||..|.|...|..|.: :.|::||.:|...|..|:||||.|.|||||
  Fly    87 TIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDI 151

  Fly   489 KSDSILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRL---PYGPEVDIWSLGI 550
            |:.:|||..:|.|||:|||..|   .:.| ..|.|||||||:||||..:   .|..:||:|||||
  Fly   152 KAGNILLTDNGVVKLADFGSAA---IKCP-ANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGI 212

  Fly   551 MVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNL-KNAHKVSPRLQSFLDRMLVRDPAQRATAAELL 614
            ..||:.:.:||:||...:.|:..|...:.|.| ||  ..|....||::..|.:.||:|.::|:||
  Fly   213 TCIELAERKPPYFNMNAMSALYHIAQNESPTLPKN--DWSDAFCSFVELCLKKMPAERPSSAKLL 275

  Fly   615 AHPFLRQAGPPSLLVPLMRNAR 636
            .|.::.:....::|:.|:...:
  Fly   276 THAYVTRPRSDTVLLELIARTK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 105/264 (40%)
S_TKc 372..619 CDD:214567 103/254 (41%)
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 103/262 (39%)
S_TKc 27..280 CDD:214567 103/258 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.