DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and stk3

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_955966.1 Gene:stk3 / 324125 ZFINID:ZDB-GENE-030131-2845 Length:492 Species:Danio rerio


Alignment Length:274 Identity:112/274 - (40%)
Similarity:166/274 - (60%) Gaps:4/274 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 PRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVET 428
            |.|..|...|:||||.|:|..|..|.:|:.||:|::.:....:.  :..|:.||:....|.:|:.
Zfish    22 PEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQE--IIKEISIMQQCDSPYVVKY 84

  Fly   429 YSSFLVNDELWVVMEYLEGGALTDIV--THSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSD 491
            |.|:..|.:||:||||...|:::||:  .:..:.|::||||.|..||.|.|||....||||||:.
Zfish    85 YGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATVLKSTLKGLEYLHFMRKIHRDIKAG 149

  Fly   492 SILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMV 556
            :|||..:|..||:|||...|::..:.||.:::|||:||:||||..:.|....|||||||..|||.
Zfish   150 NILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMA 214

  Fly   557 DGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRQ 621
            :|:||:.:..|::|:..|....||..:.....|.....|:.:.||::|.|||||.:||.|||:..
Zfish   215 EGKPPYADIHPMRAIFMIPTNPPPTFRKPEHWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIVG 279

  Fly   622 AGPPSLLVPLMRNA 635
            |.|.|:|..|:..|
Zfish   280 AKPVSILRDLITEA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 106/257 (41%)
S_TKc 372..619 CDD:214567 102/248 (41%)
stk3NP_955966.1 STKc_MST1_2 22..277 CDD:132943 105/256 (41%)
S_TKc 26..277 CDD:214567 103/252 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..339
Mst1_SARAH 438..485 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.