DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and Dsor1

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_511098.1 Gene:Dsor1 / 31872 FlyBaseID:FBgn0010269 Length:396 Species:Drosophila melanogaster


Alignment Length:287 Identity:86/287 - (29%)
Similarity:144/287 - (50%) Gaps:34/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 ENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLR-KQQRRELLFNEVVIMRDYHHPNIVETY 429
            |:|:...::|.|:.|.|.......|...:|.|.:.|. |...::.:..|:.::.:.:.|:||..|
  Fly    85 EDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAIKKQILRELKVLHECNFPHIVGFY 149

  Fly   430 SSFLVNDELWVVMEYLEGGALTDIVTHS-RMDEEQIATVCKQCLKALAYLH-SQGVIHRDIKSDS 492
            .:|..:.|:.:.|||::||:|..|:..: |:.|..:..:....||.|:||. :..:||||:|..:
  Fly   150 GAFYSDGEISICMEYMDGGSLDLILKRAGRIPESILGRITLAVLKGLSYLRDNHAIIHRDVKPSN 214

  Fly   493 ILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVD 557
            ||:.:.|.:|:.|||...|:...:  ..|.|||..:||||.:....|..:.||||||:.::||..
  Fly   215 ILVNSSGEIKICDFGVSGQLIDSM--ANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAI 277

  Fly   558 GEPPF----------------------FNEPPLQAMRRIRDM----QPPNLKNAHKV-SPRLQSF 595
            |..|.                      .:||...|:..:.|.    .||.|:  ||: |...:.|
  Fly   278 GMYPIPPPNTATLESIFADNAEESGQPTDEPRAMAIFELLDYIVNEPPPKLE--HKIFSTEFKDF 340

  Fly   596 LDRMLVRDPAQRATAAELLAHPFLRQA 622
            :|..|.:.|.:||....||:||::|:|
  Fly   341 VDICLKKQPDERADLKTLLSHPWIRKA 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 84/283 (30%)
S_TKc 372..619 CDD:214567 82/276 (30%)
Dsor1NP_511098.1 PKc_MEK 85..382 CDD:132946 86/287 (30%)
S_TKc 88..364 CDD:214567 82/279 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.