DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and Stk24

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_017171477.1 Gene:Stk24 / 223255 MGIID:2385007 Length:443 Species:Mus musculus


Alignment Length:272 Identity:110/272 - (40%)
Similarity:161/272 - (59%) Gaps:4/272 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 DPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRK-QQRRELLFNEVVIMRDYHHPNIV 426
            ||.|......|||:||.|.|....|..|.:.||:|.:||.: :...|.:..|:.::.....|.:.
Mouse    31 DPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVT 95

  Fly   427 ETYSSFLVNDELWVVMEYLEGGALTDIVTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSD 491
            :.|.|:|.:.:||::||||.||:..|::....:||.||||:.::.||.|.||||:..||||||:.
Mouse    96 KYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDEIQIATILREILKGLDYLHSEKKIHRDIKAA 160

  Fly   492 SILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMV 556
            ::||:..|.|||:|||...|::....||.:.||||:||:||||.:..|..:.|||||||..||:.
Mouse   161 NVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELA 225

  Fly   557 DGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPF-LR 620
            .||||.....|::.:..|....||.|:..:  |..|:.|::..|.::|:.|.||.|||.|.| :|
Mouse   226 KGEPPHSELHPMKVLFLIPKNNPPTLEGNY--SKPLKEFVEACLNKEPSFRPTAKELLKHKFIIR 288

  Fly   621 QAGPPSLLVPLM 632
            .|...|.|..|:
Mouse   289 NAKKTSYLTELI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 105/258 (41%)
S_TKc 372..619 CDD:214567 102/248 (41%)
Stk24XP_017171477.1 STKc_MST3_like 34..307 CDD:270786 108/269 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.