DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and Oxsr1

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001346511.1 Gene:Oxsr1 / 108737 MGIID:1917378 Length:527 Species:Mus musculus


Alignment Length:281 Identity:105/281 - (37%)
Similarity:158/281 - (56%) Gaps:23/281 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 RENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRK-QQRRELLFNEVVIMRDYHHPNIVET 428
            |::.:....||.|:|..|..|.......:||:|:::|.| |...:.|..|:..|...||||||..
Mouse    14 RDDYELQEVIGSGATAVVQAAYCAPKKERVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSY 78

  Fly   429 YSSFLVNDELWVVMEYLEGGALTDIVTH---------SRMDEEQIATVCKQCLKALAYLHSQGVI 484
            |:||:|.||||:||:.|.||::.||:.|         ..:||..|||:.::.|:.|.|||..|.|
Mouse    79 YTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDEPTIATILREVLEGLEYLHKNGQI 143

  Fly   485 HRDIKSDSILLAADGRVKLSDFGFCAQVSQ--ELPK---RKSLVGTPYWMSPEVISRL-PYGPEV 543
            |||:|:.:|||..||.|:::|||..|.::.  ::.:   ||:.||||.||:|||:.:: .|..:.
Mouse   144 HRDVKAGNILLGEDGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKA 208

  Fly   544 DIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNA-------HKVSPRLQSFLDRMLV 601
            ||||.||..||:..|..|:...||::.:.......||:|:..       .|.....:..:...|.
Mouse   209 DIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQ 273

  Fly   602 RDPAQRATAAELLAHPFLRQA 622
            :||.:|.||||||.|.|.::|
Mouse   274 KDPEKRPTAAELLRHKFFQKA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 104/277 (38%)
S_TKc 372..619 CDD:214567 102/269 (38%)
Oxsr1NP_001346511.1 STKc_OSR1_SPAK 15..291 CDD:270787 102/275 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..356
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.