DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and pak5

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001120110.1 Gene:pak5 / 100145129 XenbaseID:XB-GENE-960008 Length:349 Species:Xenopus tropicalis


Alignment Length:365 Identity:103/365 - (28%)
Similarity:135/365 - (36%) Gaps:120/365 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSKKKKKPLISMPSNFEHRVHTGFDKRENKYVGLPLQWASIVGNNQILKSSNRPLPLVDPSEIT 65
            ||.|||||..||.|||||||||||||.:|.|::|||.||.|::.:     ::|||.|:||||.||
 Frog     1 MFGKKKKKLDISGPSNFEHRVHTGFDHKEQKFIGLPQQWQSLLAD-----TANRPKPMVDPSCIT 60

  Fly    66 PTEILDLKTIVRPHHNNNKADTTSLNSSSTMMMGSMAPMNPMAPGAHPMMSHGPGMMMPPETGGI 130
            |.::..:|||||                     ||..|.:....|            :..:...|
 Frog    61 PIQLAPMKTIVR---------------------GSKPPQDTYING------------LLEDFDNI 92

  Fly   131 VLPKTSHVARSNSLRSSSPPRVR-RVANVPPSVPEEEG---------PPAAGTPGVG-------- 177
                  .|.||||||..|||..| ..:|.....|||.|         .|......:.        
 Frog    93 ------SVTRSNSLRKESPPTPRLGHSNHLKGYPEENGFFAFSQYSCEPEVQRSNISERYKERSL 151

  Fly   178 GASSG-----GFKP--PGAHPSLL-------------------YNSQHAHANGATGPLAVRTDQ- 215
            .|...     ..||  ...||..:                   |.|:: |....|...:|  || 
 Frog   152 SAEEAEVYYRANKPVRHNGHPVKMRSYETYFPEVKSVRADLSSYPSEY-HPQLETKSKSV--DQY 213

  Fly   216 -------TNLQQYRSNLAPPSGGSMPQQQQTSPVGSVASGTRSNHSHTNNGNSGGSYPPMYPTSH 273
                   |:||.||....|...|::        :.|..|..|..:|....|.....|.....:|:
 Frog   214 DYHSIAGTSLQDYRDYFPPSITGTI--------MLSEGSRERLEYSEWGEGLPKDDYDKRPKSSY 270

  Fly   274 QQQ---QQQQQQAKQGGDQNQNPLHPH----------AHP 300
            ..|   |...:|..:.|...|.|:.|:          .||
 Frog   271 ITQTSPQPAMRQRSRSGSGLQEPIIPYGAGVMKTNQQGHP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526 23/44 (52%)
STKc_PAK_II 360..620 CDD:270815
S_TKc 372..619 CDD:214567
pak5NP_001120110.1 CRIB_PAK_like 11..55 CDD:238526 27/48 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 420 1.000 Domainoid score I636
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 595 1.000 Inparanoid score I959
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D131221at33208
OrthoFinder 1 1.000 - - FOG0001853
OrthoInspector 1 1.000 - - otm48630
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3286
SonicParanoid 1 1.000 - - X1054
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.