DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup153 and Pom121l12

DIOPT Version :9

Sequence 1:NP_001097002.1 Gene:Nup153 / 32630 FlyBaseID:FBgn0061200 Length:1929 Species:Drosophila melanogaster
Sequence 2:XP_002728172.1 Gene:Pom121l12 / 100361125 RGDID:2320735 Length:271 Species:Rattus norvegicus


Alignment Length:314 Identity:63/314 - (20%)
Similarity:82/314 - (26%) Gaps:120/314 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1412 GFSFGAPSSSSTVSSSTTSTSANPAAVKPMFSWSGAGSAVSSTSSSQQPVAKAP----------- 1465
            |.|.|:|..|       .|...||.: :|...|           ..|.|..|.|           
  Rat     2 GSSLGSPQRS-------LSAPRNPRS-RPWSEW-----------VQQSPRPKVPVHLHTPQRALG 47

  Fly  1466 -------------TLGFGVSSSTVTTTTTSTKVFAFT---PASGLDPAAATSAPAAGAGFSFG-- 1512
                         |||..:|::    ..|..|.:.::   |.....|.....||..|.|.:..  
  Rat    48 TWRRSAIRPSTDATLGLDLSNA----WDTYMKRWLWSVRNPGWTCSPVTVKIAPPEGRGSTLTSS 108

  Fly  1513 --------------------------SQSKPATTQNTGTFFFGQPTAVAPATPTNPSVSSIFGAP 1551
                                      ||.|....:..|..:|..|..........|..||.|   
  Rat   109 GLGVRIPEHPEKLPDPCAKETVLRALSQCKKGARRFDGPLWFEVPEVKNRRQNPEPKRSSAF--- 170

  Fly  1552 ATSTTASTSVSATTSTSTANAIASSFAPTSTP------QLFGNWGEKKTDL-----TTFGASS-- 1603
                          .....|.:.:||.|...|      .:..|..:|:|||     |...|.|  
  Rat   171 --------------KPWIKNGVVTSFVPKPGPLKRSIDYMSFNVCKKETDLQSCIHTAMNAVSER 221

  Fly  1604 ------GSGTTTTPSFGWSSNGDAAKSNSAAVGSAAVPSSSASTMATPIFGSSS 1651
                  .|..:..|..     ....||.|..|..|.....|..:.|.| ||.||
  Rat   222 HMESFEKSRVSCDPCL-----SPGPKSGSYGVSLAGGDFHSCLSSAIP-FGDSS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup153NP_001097002.1 Nup153 <458..910 CDD:285770
RanBP2-type Zn finger 864..883 CDD:275375
zf-RanBP 903..931 CDD:279035
RanBP2-type Zn finger 907..926 CDD:275375
zf-RanBP 968..992 CDD:279035
RanBP2-type Zn finger 968..987 CDD:275375
zf-RanBP 1009..1038 CDD:279035
RanBP2-type Zn finger 1013..1032 CDD:275375
zf-RanBP 1072..1097 CDD:279035
RanBP2-type Zn finger 1072..1091 CDD:275375
zf-RanBP 1126..1155 CDD:279035
RanBP2-type Zn finger 1130..1149 CDD:275375
ZnF_RBZ 1239..1261 CDD:197784
RanBP2-type Zn finger 1241..1260 CDD:275375
Pom121l12XP_002728172.1 POM121 156..>221 CDD:405826 17/81 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.