DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and INP51

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_012264.3 Gene:INP51 / 854815 SGDID:S000001264 Length:946 Species:Saccharomyces cerevisiae


Alignment Length:417 Identity:124/417 - (29%)
Similarity:183/417 - (43%) Gaps:71/417 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQVLGLFKE 97
            ::..|:|:..:.|.:       .::|....|...:.: .:.|:|.:||:||.......:|.   .
Yeast   529 IFAGTFNISGKIPKD-------DIKDWIFPKSMSKED-EMADLYVIGLEEVVELTPGHMLA---T 582

  Fly    98 DP-----WTHKAKELL----RNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGI 153
            ||     |..|...||    |...|:.:.:.|:.|:||.:|:.......::.||.:..:|||||:
Yeast   583 DPYVRQFWEKKILTLLNGPGRKKKYIRLWSTQLGGILLLLFMNETEYSKVKHIEGDVKKTGFGGM 647

  Fly   154 WGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHVKRYREIYDHDYVFWF 218
            ..|||||:|.|.........:|:||.|....:::|..|||.|.::..:  .:...|.|||.:.|.
Yeast   648 ASNKGAVAVSFKYSATRFCVLVSHLAAGLENVEQRHNDYKTIAKSIRF--SKGLRIKDHDAIIWM 710

  Fly   219 GDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREG 283
            ||.|:|:..|:.... |::|..|  :.:|.::|||.|.....: :|....|....||||:||..|
Yeast   711 GDFNYRILMSNEDVR-RKIVSKE--YASLFEKDQLNQQMIAGE-SFPYFHEMAIDFPPTYKFDPG 771

  Fly   284 TSEYDLK---RRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFTIKLYP 345
            |..||..   |.|||||||:...:.|          ||..||.......|||:||        |.
Yeast   772 TKNYDTSEKMRIPAWTDRILSRGEVL----------EQLEYKCCEDILFSDHRPV--------YA 818

  Fly   346 NVRAPGVVFSPLSLWKIGDENTVEYHKQAEFDEGSNDWIGIFPSEYASLAD--YVAYEYVNQAES 408
            ..||...|........:|   |..|.|..|..||.:|     ..:.|.|:|  :|       .||
Yeast   819 IFRARVTVVDEQKKTTLG---TQIYEKIMERLEGLDD-----DEKIAVLSDDAFV-------IES 868

  Fly   409 PSSSDS----NHQPDPFETPSHHRRGR 431
            ...|||    .|.|.|...|   :|||
Yeast   869 FEGSDSIAGPTHSPTPIPEP---KRGR 892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 96/319 (30%)
INP51NP_012264.3 COG5329 1..501 CDD:227637
COG5411 498..946 CDD:227698 124/417 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.