DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and INP54

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_014576.1 Gene:INP54 / 854089 SGDID:S000005426 Length:384 Species:Saccharomyces cerevisiae


Alignment Length:387 Identity:107/387 - (27%)
Similarity:165/387 - (42%) Gaps:92/387 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YRVYVVTWNVGSRFPDNIS---LRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQVL 92
            ::|.|.|:|.|..||...|   ::.||...|..:      :...|.|:|.||.|||....|....
Yeast     6 WKVSVTTFNCGKEFPVENSKAIVKQLLFPYDDGI------SQLELQDLYVLGFQEVVPIWQGSFP 64

  Fly    93 GLFKE--DPWTHKAKELLR--------NYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEFTR 147
            .:.::  |..|..|...|.        :..|..:....:..:.:.:......::...||   ..|
Yeast    65 AVNRDLIDRITTTAVNCLNEKVSATQGDEQYSCLGVNSLGAITIIVLYNNNALKVKDDI---LKR 126

  Fly   148 TGFGGIWGN--KGAVSVRFTLYGCG------LAFVVAHLTAHD--HMMDERIEDYKQILENHHYH 202
            .|..|.:|.  ||...:.|.:...|      .:::.|||.|::  :..::||:|||:|:.     
Yeast   127 NGKCGWFGTHLKGGTLISFQMTRNGEENWERFSYICAHLNANEGVNNRNQRIDDYKRIMS----- 186

  Fly   203 VKRYREIYD-----HDYVFWFGDLNFRLQGS-------DSSTEVRELVRDESQHEALIQRDQLYQ 255
                 |:.|     .|:.|:.||||||:..:       .|:|.:|.|:.:   ||.|    .|.:
Yeast   187 -----EVCDSEVAKSDHFFFLGDLNFRVTSTYDPTTNYSSTTTLRRLLEN---HEEL----NLLR 239

  Fly   256 VREKSQLAFQVLQERLPAFPPTFKFREGTSE-YDLKRRPAWTDRIM---YAVQPLNRQPGMQLSI 316
            ..|...|. :..||....||||:||:....| |:.||.|:|.|||:   ||| |...|.|...|:
Yeast   240 KGEDEPLC-KGFQELKITFPPTYKFKLFEKETYNTKRIPSWCDRILYKSYAV-PTFAQEGTYHSV 302

  Fly   317 EQCSYKSHPLYTISDHKPVTSDFTIKLYPNVRAPGVVFSPLSL--------W------KIGD 364
            .    :|:.| ..|||:||  :.|::|..:...|    .||||        |      :|||
Yeast   303 P----RSNAL-LFSDHQPV--NLTVRLPRSTGTP----VPLSLHIEKYPLSWSSGLIGQIGD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 96/348 (28%)
INP54NP_014576.1 COG5411 1..371 CDD:227698 107/387 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1642
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.