DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and Synj1

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_038944618.1 Gene:Synj1 / 85238 RGDID:69434 Length:1609 Species:Rattus norvegicus


Alignment Length:434 Identity:129/434 - (29%)
Similarity:199/434 - (45%) Gaps:95/434 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RVYVVTWNV--GSRFPDNISLRH------------LLGLQDVTVDKDTKETNAHLPDIYALGLQE 82
            ||.|.||||  |.:| .:|:.::            |.|:|:.. ||.:|.|     ||:|:|.:|
  Rat   577 RVCVGTWNVNGGKQF-RSIAFKNQTLTDWLLDAPKLAGIQEFQ-DKRSKPT-----DIFAIGFEE 634

  Fly    83 ---------VNAQPQQQVLGLFKEDPW-THKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEH 137
                     |||....|.|       | ....|.:.|:..||.:.:||:.|:.|.:|:|.||...
  Rat   635 MVELNAGNIVNASTTNQKL-------WAVELQKTISRDNKYVLLASEQLVGVCLFVFIRPQHAPF 692

  Fly   138 LQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYH 202
            ::|:..:..:||.||..||||||::|...:...|.||.:|..|....:.||.||:.:|.....:.
  Rat   693 IRDVAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDFVEIARKLSFP 757

  Fly   203 VKRYREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVL 267
            :.|.  ::.||||||.||.|:|:...:.  ||:||:|.:: .::||..|||...:...|: |:..
  Rat   758 MGRM--LFSHDYVFWCGDFNYRIDLPNE--EVKELIRQQN-WDSLIAGDQLINQKNAGQI-FRGF 816

  Fly   268 QERLPAFPPTFKFREGTSEYDLK---RRPAWTDRIMYAVQ--PLNRQPGMQLSIEQCSY--KSHP 325
            .|....|.||:|:...:.:||..   |.||||||:::..:  |.:|. ...|.:...|:  :|..
  Rat   817 LEGKVTFAPTYKYDLFSEDYDTSEKCRTPAWTDRVLWRRRKWPFDRS-AEDLDLLNASFQDESKI 880

  Fly   326 LYT---------------ISDHKPVTS--DFTI---------KLYPNVRA-----PGVVFSPLSL 359
            |||               .|||:||.:  |..|         |:|..|.|     .|.|.  :|:
  Rat   881 LYTWTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQKIYKEVIAVQGPPDGTVL--VSI 943

  Fly   360 WKIGDENTVEYHKQAEFDEGSNDWIGIFPSEYASLADYVAYEYV 403
            .....|||  :...|..||        ...::|...:.:...:|
  Rat   944 KSSAQENT--FFDDALIDE--------LLQQFAHFGEVILIRFV 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 113/356 (32%)
Synj1XP_038944618.1 COG5329 100..523 CDD:227637
INPP5c_Synj1 576..911 CDD:197332 112/354 (32%)
RRM_SF 910..1052 CDD:418427 17/80 (21%)
PHA03247 <1097..1498 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.