DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and AT1G71710

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_565023.1 Gene:AT1G71710 / 843501 AraportID:AT1G71710 Length:664 Species:Arabidopsis thaliana


Alignment Length:383 Identity:100/383 - (26%)
Similarity:164/383 - (42%) Gaps:93/383 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKIPDSEPDGSKGKGKQQLETYRVYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKETNAHLPD 74
            |.:.|.:|.....|..:..::::.|             .|.:.:.|           ..|...|:
plant   347 PCVLDRQPSIKTVKSLKTAKSFKAY-------------SSFKSVAG-----------NNNGIPPE 387

  Fly    75 IYALGLQEVNAQPQQQVLGLFKEDPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQ 139
            :.||...::....:::                  |...||.:.::||.|:||:::|:|...:|:|
plant   388 VLALAEMDLKLLMERK------------------RRPAYVRLVSKQMVGILLTIWVKRSLRKHIQ 434

  Fly   140 DIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDE--RIEDYKQILENHHYH 202
            ::.......|..|..||||||||..::......|:..||||.:..:|:  |..|..:|.:...:|
plant   435 NVRVSTVGVGVMGYIGNKGAVSVSMSINQTFFCFINTHLTAGEREVDQIKRNADVHEIHKRTVFH 499

  Fly   203 ----VKRYREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLA 263
                :...:.||||:.:.|.||||:||  |.|..:.|:|: .:.:...|::.|||.:...|.: |
plant   500 SVSALGLPKLIYDHERIIWLGDLNYRL--SSSYEKTRDLI-SKREWSKLLEYDQLVKEYRKGR-A 560

  Fly   264 FQVLQERLPAFPPTFKFREGTSEYDL------KRRPAWTDRIMYAVQPLNRQPGMQL----SIEQ 318
            |....|....||||:|::..:.||..      ||.|||.||:      |:...||:|    ..||
plant   561 FDGWSEGTLHFPPTYKYQANSDEYTANDGKAPKRTPAWCDRV------LSYGKGMRLVHYRRTEQ 619

  Fly   319 CSYKSHPLYTISDHKPVTSDFTIKLYPNVRAPGVVFSPLSLWK--------IGDENTV 368
                     ..|||:|||:.:..::        .|||...|.:        |.||..|
plant   620 ---------KFSDHRPVTAIYMAEV--------EVFSARKLQRALTFTDAEIEDEGLV 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 88/325 (27%)
AT1G71710NP_565023.1 EEP 10..652 CDD:382041 96/373 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.