DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and 5PTASE11

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_175182.2 Gene:5PTASE11 / 841160 AraportID:AT1G47510 Length:334 Species:Arabidopsis thaliana


Alignment Length:326 Identity:96/326 - (29%)
Similarity:155/326 - (47%) Gaps:67/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQE-----------VNAQ 86
            :.::|||:..    |:|...|:.|    |.|:.|.      |:..:||||           ..:.
plant    56 IRIITWNMNG----NVSYEDLVEL----VGKERKF------DLLVVGLQEAPKANVDQLLQTASS 106

  Fly    87 PQQQVLGLFKEDPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAE-FTRTGF 150
            |..::||         |||               :|.:.|.:|..:.....:::::|| ::..|.
plant   107 PTHELLG---------KAK---------------LQSVQLYLFGPKNSHTLVKELKAERYSVGGC 147

  Fly   151 GGIWG-NKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHVKRYREIYDHDY 214
            ||:.| .||||::|.......:.|:..||:||...:|:|..:.:.|..:.....||.|     |.
plant   148 GGLIGRKKGAVAIRINYDDIKMVFISCHLSAHAKKVDQRNTELRHIANSLLPRDKRKR-----DL 207

  Fly   215 VFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFK 279
            ..|.||||:|:| ..|:..||.|:::..| ..|:.:|||.|..|:.:: |:...|....|.||:|
plant   208 TVWLGDLNYRIQ-DVSNHPVRSLIQNHLQ-SVLVSKDQLLQEAERGEI-FKGYSEGTLGFKPTYK 269

  Fly   280 FREGTSEYDLK---RRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFTI 341
            :..|:|:||..   |.|||||||::.:|..:   .:|.::.  ||.|......||||||.:|..:
plant   270 YNVGSSDYDTSHKIRVPAWTDRILFKIQDTD---NIQATLH--SYDSIDQVYGSDHKPVKADLCL 329

  Fly   342 K 342
            |
plant   330 K 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 95/323 (29%)
5PTASE11NP_175182.2 EEP 56..325 CDD:294334 94/319 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136409
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11200
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1469
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.