DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and 5PTASE13

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_172054.3 Gene:5PTASE13 / 837069 AraportID:AT1G05630 Length:1170 Species:Arabidopsis thaliana


Alignment Length:404 Identity:107/404 - (26%)
Similarity:155/404 - (38%) Gaps:116/404 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ETYRVYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQVLG 93
            :..|:.:.|||||.....:.:|...||  .||.|          ..|.|:|||||........:.
plant   569 DNVRILIGTWNVGQGRASHDALMSWLG--SVTSD----------VGIVAVGLQEVEMGAGFLAMS 621

  Fly    94 LFKE---------DPWTHKA--KELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEFTR 147
            ..||         ..|...|  |.|.....:..:.:.|:.|||:|::.|:....|:.|::.....
plant   622 AAKETVGLEGSAVGQWWIDAIGKALDEKNTFERMGSRQLAGLLISLWARKDIRTHVGDLDVAAVP 686

  Fly   148 TGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHV---KRYREI 209
            .|||...||||.|.:|..:|...:.||..||.||...::.|..|:     ||.:.:   .|.:.:
plant   687 CGFGRAIGNKGGVGLRIRVYDRIMCFVNCHLAAHLEAVNRRNADF-----NHIFRLMVFSRGQNL 746

  Fly   210 YD-----------------HDYVFW---------------------------------------- 217
            .:                 ..|:||                                        
plant   747 SNAAAGMVPYLFLSCSLGFSTYLFWLLYSSGLPWALSLAAGVSTSAYTTKSNTIPSTGAEEIKSD 811

  Fly   218 ---------FGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQERLPA 273
                     |||.|:||.|. :..|.|:.:...| .:.|.:|||| :...|....||.::|.|..
plant   812 LAAADMVAFFGDFNYRLFGI-TYDEARDFISQRS-FDWLRERDQL-RAEMKVGKVFQGMREALIT 873

  Fly   274 FPPTFKF---REGTSEYD---LKRRPAWTDRIMYAVQPLNRQPGMQLSIEQC-------SYKSHP 325
            ||||:||   |.|...||   .||.|||.||::|  :.....|..:.:: ||       .|::..
plant   874 FPPTYKFERNRSGLGGYDSGEKKRIPAWCDRVIY--RDTQSSPFSESNL-QCPVVSSVIMYEACM 935

  Fly   326 LYTISDHKPVTSDF 339
            ..|.||||||...|
plant   936 DVTESDHKPVRCKF 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 107/402 (27%)
5PTASE13NP_172054.3 WD40 <164..374 CDD:225201
WD40 207..>294 CDD:295369
WD40 repeat 446..474 CDD:293791
WD40 repeat 481..514 CDD:293791
RAB3GAP2_N 491..>523 CDD:291327
WD40 repeat 520..556 CDD:293791
INPP5c 571..951 CDD:197308 107/402 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11200
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.