DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and AT5G04980

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001078529.1 Gene:AT5G04980 / 830380 AraportID:AT5G04980 Length:466 Species:Arabidopsis thaliana


Alignment Length:452 Identity:102/452 - (22%)
Similarity:165/452 - (36%) Gaps:168/452 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QQLETYRVYVVTWNVGSRFP-DNISLRHLLGLQDVTVDKDTKETNAHLP-DIYALGLQEV---NA 85
            ||:::.||:|.|||||.:.| ..::|..||              :.|.. |:|.||.||:   ||
plant    33 QQIQSLRVFVATWNVGGKSPHSGLNLDALL--------------HVHSEFDVYVLGFQEIVPLNA 83

  Fly    86 ----------------------------------QPQQQVLG---LFKEDPWTHK---------- 103
                                              .|:....|   :|...|...|          
plant    84 GNVLVLGDNEPAAKWLAMINQSLNKSSSSSGGRLSPKTPSFGAGSMFFAKPSLKKISESFRTECR 148

  Fly   104 -----------AKELLRNY---------------------------------------------- 111
                       :::::|.|                                              
plant   149 RKLKICNCSTFSEDIVRKYGRESCFRCPEGLVNQSGVLSDDEEDEDDDDDDEDEDEGGGKVASLV 213

  Fly   112 ------DYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCG 170
                  .|..|.::||.|:.|::::|::.::|:..:.......|..|..||||.::|...||...
plant   214 SNQMTMKYGLVASKQMVGIFLTVWMRKELIQHVSHLRISSVTRGIMGCLGNKGCIAVSLQLYKTS 278

  Fly   171 LAFVVAHLTAHDHMMDERIE--DYKQILENHHY-------HVKRYREIYDHDYVFWFGDLNFRLQ 226
            ..|:.:||.:.:...|||..  |..:||:|..:       ..:....|..||.|.|.||||:|:.
plant   279 FCFICSHLASGEREGDERRRNLDVIEILKNTSFPRICRTSFTRVPDRITKHDRVIWLGDLNYRIA 343

  Fly   227 GSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREGTSEY---- 287
            .|.|.|:.   :.|::..:.|:.:|||...|:..:: |:...|....|.||:|:...:..|    
plant   344 LSYSETKT---LLDKNAWDTLLNKDQLKIERDAGRV-FKGWHEGKIFFAPTYKYSYNSDAYAGDT 404

  Fly   288 -----DLKRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSY---KSHPLYTISDHKPVTSDFTI 341
                 :.:|.|||.|||::...          .|.|.||   :|.    .|||:||.|.|.:
plant   405 SKEKKNKRRTPAWCDRILWHGD----------GIRQLSYVRGESR----FSDHRPVCSVFVV 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 100/445 (22%)
AT5G04980NP_001078529.1 EEP 36..456 CDD:294334 100/449 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.