DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and 5PTase12

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001323432.1 Gene:5PTase12 / 818994 AraportID:AT2G43900 Length:1348 Species:Arabidopsis thaliana


Alignment Length:395 Identity:110/395 - (27%)
Similarity:165/395 - (41%) Gaps:78/395 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKIPDSEPDG-------SKGKGKQQLETYRVYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKE 67
            |.|.....||       .|.:...|.::.|:...:||||.....:.:|...||    :|..|.  
plant   548 PVISPGPLDGIIRSELAEKERTYAQTDSVRILTGSWNVGQGKASHDALMSWLG----SVASDV-- 606

  Fly    68 TNAHLPDIYALGLQEVNAQPQQQVLGLFKEDP-----------WTHK-AKELLRNYDYVAVKTEQ 120
                  .|..:|||||........:...||..           |... .|.|.....:..:.:.|
plant   607 ------GILVVGLQEVEMGAGFLAMSAAKESVGGNEGSTIGQYWIDTIGKTLDEKAVFERMGSRQ 665

  Fly   121 MQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMM 185
            :.|||:|::||:....|:.||:......|||...||||.|.:|..::...:.|:..||.||...:
plant   666 LAGLLISLWVRKNLRTHVGDIDVAAVPCGFGRAIGNKGGVGLRIRVFDRIMCFINCHLAAHLEAV 730

  Fly   186 DERIEDYKQILE--------NHH----------YHVKR------------YREIYDHDYVFWFGD 220
            :.|..|:..|.:        |.|          .|..:            .:::.:.|.|.:|||
plant   731 NRRNADFDHIYKTMSFTRSSNAHNAPAAGVSTGSHTTKSANNANVNTEETKQDLAEADMVVFFGD 795

  Fly   221 LNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKF---RE 282
            .|:||.|. |..|.|:.|...| .:.|.::||| :...|:...||.::|.:..||||:||   |.
plant   796 FNYRLFGI-SYDEARDFVSQRS-FDWLREKDQL-RAEMKAGRVFQGMREAIITFPPTYKFERHRP 857

  Fly   283 GTSEYD---LKRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLY------TISDHKPVTSD 338
            |...||   .||.|||.||:::  :.....|..:.|::.....|..||      |.||||||...
plant   858 GLGGYDSGEKKRIPAWCDRVIF--RDTRTSPESECSLDCPVVASIMLYDACMDVTESDHKPVRCK 920

  Fly   339 FTIKL 343
            |.:|:
plant   921 FHVKI 925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 103/363 (28%)
5PTase12NP_001323432.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11200
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.