DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and AT2G37440

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001323804.1 Gene:AT2G37440 / 818321 AraportID:AT2G37440 Length:479 Species:Arabidopsis thaliana


Alignment Length:369 Identity:101/369 - (27%)
Similarity:163/369 - (44%) Gaps:87/369 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RVYVVTWNVGSRFP-DNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQVLGLF 95
            :::|.|||||.:.| :.:.|            ||..::.|. .|||.||.||:.......|||..
plant    84 KMFVGTWNVGGKSPHEGLDL------------KDWLKSPAD-ADIYVLGFQEIVPLNAGNVLGAE 135

  Fly    96 KEDP---WTHKAKELLRNYD--------------------------------------YVAVKTE 119
            ...|   |....:|.|.|.:                                      |....::
plant   136 DNGPAAKWLSLIREALNNTNNLSPNELEHTKSSQQPRFSFSGLSDDTPIPCNSTPPRGYSLAASK 200

  Fly   120 QMQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHM 184
            ||.|:.|.::||....:.:.:::......|..|..||||:||:..:|:...|.||..|||:.:..
plant   201 QMVGIFLCVWVRDDLRKRITNLKVSCVGRGIMGYLGNKGSVSISMSLHETSLCFVCTHLTSGEKE 265

  Fly   185 MDE--RIEDYKQILENHHY----HVKRYREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQ 243
            .||  |..|..:|.:...:    ...|...|.|||.|.|.||||:||:   :|:::.|.:|:. .
plant   266 GDELRRNLDVTEIFKRTRFSRSSKDSRPETIMDHDKVIWLGDLNYRLR---ASSDLHEQLRNH-D 326

  Fly   244 HEALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREGTSEY--------DLKRRPAWTDRIM 300
            .|:|:::||| ::.:::...|:..:|....|.||:|:|..:..|        :.:|.|||.|||:
plant   327 WESLLEKDQL-KIEQRAGRIFKGWEEGKIYFAPTYKYRINSDNYVVQTEKSKEKRRTPAWCDRIL 390

  Fly   301 YAVQPLNRQPGM-QLSIEQCSYKSHPLYTISDHKPVTSDFTIKL 343
            :      :..|| ||...:...|      .|||:||.|.|::.:
plant   391 W------KGDGMKQLWYVRGESK------FSDHRPVQSLFSVHI 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 101/365 (28%)
AT2G37440NP_001323804.1 EEP 6..424 CDD:412407 101/369 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.