DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and CVL1

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001189654.1 Gene:CVL1 / 817761 AraportID:AT2G32010 Length:594 Species:Arabidopsis thaliana


Alignment Length:266 Identity:81/266 - (30%)
Similarity:127/266 - (47%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSVR 163
            ||        .:..|..|.::||.|:.|:::|:.:..||:::::......|..|..||||::|:.
plant   320 PW--------NSSQYCLVASKQMVGIFLTIWVKSELREHVKNMKVSCVGRGLMGYLGNKGSISIS 376

  Fly   164 FTLYGCGLAFVVAHLTAHDHMMDE--RIEDYKQILENHHY-------HVKRYREIYDHDYVFWFG 219
            ..|:.....||..|||:.....||  |..|..:||:...:       ..|....|..||.|.|.|
plant   377 MLLHQTSFCFVCTHLTSGQKEGDELRRNSDVMEILKKTRFPRVQSSADEKSPENILQHDRVIWLG 441

  Fly   220 DLNFRLQGSDSSTEVRELVRDESQH-EALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREG 283
            |||:|:..|..|  .:.||  |.|: .||::.||| ::.:|....|:...|....||||:|:...
plant   442 DLNYRIALSYRS--AKALV--EMQNWRALLENDQL-RIEQKRGHVFKGWNEGKIYFPPTYKYSNN 501

  Fly   284 TSEY---DL-----KRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFT 340
            :..|   ||     :|.|||.|||::..:.|:     |||..:...:      .|||:||...|:
plant   502 SDRYAGGDLHPKEKRRTPAWCDRILWHGEGLH-----QLSYVRGESR------FSDHRPVYGIFS 555

  Fly   341 IKLYPN 346
            .::..|
plant   556 AEVESN 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 80/259 (31%)
CVL1NP_001189654.1 EEP 17..582 CDD:412407 81/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.