DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and 5PTase14

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001189651.1 Gene:5PTase14 / 817740 AraportID:AT2G31830 Length:1173 Species:Arabidopsis thaliana


Alignment Length:484 Identity:127/484 - (26%)
Similarity:188/484 - (38%) Gaps:127/484 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ETYRVYVVTWNVGSRFPDNISLRHLLG--LQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQV 91
            ::.::.:.|||||.......:|...||  :.||              .|.|:|||||:.......
plant   578 DSVKILIGTWNVGEGRASRGALVSWLGSAVSDV--------------GIVAIGLQEVDMGAGFLA 628

  Fly    92 LGLFKEDP----------WTHKAKELL--RNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAE 144
            :...||..          |.......|  || .:..:.:.|:.|||:|::||:....|:.|::..
plant   629 MSTAKETVGVEGSAVGQWWLDAIGNALDERN-TFERMGSRQLAGLLISLWVRKSIRTHVGDLDVA 692

  Fly   145 FTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYK---------------- 193
            ....|||...||||.|.:|..:|...:.||..||.||...:..|..|:.                
plant   693 AVPCGFGRAIGNKGGVGLRIRVYDRIMCFVNCHLAAHLEAVTRRNADFNHIYRSMVFSKGQSVYT 757

  Fly   194 ----------QILENHHYHVKRYREIYDH----DYVFWFGDLNFRLQGSDSSTEVRELVRDESQH 244
                      |.|:|:........|...|    |.|.:|||.|:||.|. :..|.|:.:...| .
plant   758 AAAAGASTSAQALKNNPNTNNSTEEEKSHLASADLVAFFGDFNYRLFGI-TYDEARDFISHRS-F 820

  Fly   245 EALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKF---REGTSEYD---LKRRPAWTDRIMYAV 303
            :.|.::|||.|...:.:: ||.::|.|..||||:||   :.|...||   .||.|||.||::|  
plant   821 DWLREKDQLRQEMNEGKV-FQGMREALITFPPTYKFEKNKPGLGGYDSGEKKRIPAWCDRVIY-- 882

  Fly   304 QPLNRQPGMQLSIEQCSYK-----SHPLY------TISDHKPVTSDFTIKLYPNV---------- 347
                 :....:|..:||.|     |..:|      |.||||||    ..||:.|:          
plant   883 -----RDNQSISYTECSLKCPVVSSTIMYEACMDVTESDHKPV----RCKLHANIAHTDKSVRRQ 938

  Fly   348 RAPGVVFSPLSLWKIGDE-----------NTVEYHKQAEFDEGSNDWIGIFPSEYASLADYVAYE 401
            ....:|.|...|..:.:|           |.:..|.|..|         ||.....|.:....:.
plant   939 ELGKIVKSNEKLRAMFEELKSVPETSVSTNNILLHSQDTF---------IFTIRNTSNSSRAIFN 994

  Fly   402 YVNQAESPSSSDSNHQPDPFETPSHHRRG 430
            .|.:.::....|.       |.|.:|.||
plant   995 IVCKGQTLVREDG-------EEPDNHSRG 1016

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 106/370 (29%)
5PTase14NP_001189651.1 WD40 218..551 CDD:295369
WD40 <218..384 CDD:225201
WD40 repeat 451..484 CDD:293791
WD40 repeat 490..523 CDD:293791
WD40 repeat 529..565 CDD:293791
INPP5c 580..926 CDD:197308 108/374 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11200
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.