DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and AT2G01900

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001323555.1 Gene:AT2G01900 / 814721 AraportID:AT2G01900 Length:425 Species:Arabidopsis thaliana


Alignment Length:392 Identity:114/392 - (29%)
Similarity:172/392 - (43%) Gaps:77/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KQQLETYRVYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQ 89
            |..|..|:|:|.|||||...||:       || |:   :|..||:....|||.||.|||......
plant    60 KTTLLNYKVFVSTWNVGGIVPDD-------GL-DM---EDLLETHKTPCDIYVLGFQEVVPLRAS 113

  Fly    90 QVLGLFK---EDPWT-------------HKAKELLR-------NYDYVAVKTEQMQGLLLSMFVR 131
            .|||...   ...|.             |:.::|..       :.|:..:.::||.|:|::::||
plant   114 NVLGSDNNKVSTKWNSLIRDALNKRARPHRDEDLSESKGINGISQDFRCIISKQMVGILITVWVR 178

  Fly   132 RQHVEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDE--RIEDYKQ 194
            .....:::.........|..|..||||:|||||.|:.....||.:||.:.....||  |..|..:
plant   179 GDLWPYIRYPSVSCVGCGIMGCLGNKGSVSVRFQLHETTFCFVCSHLASGGRDRDERQRNSDVNE 243

  Fly   195 ILENHHY----HVKRYREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQ 255
            ||....:    .:...::|.|||.|.:.||||:|:...:..|   .|:.:..:...|::.|||..
plant   244 ILARSSFPRGSSLDLPKKILDHDRVIFLGDLNYRISLPEEKT---RLLVESKKWNILLENDQLRM 305

  Fly   256 VREKSQLAFQVLQERLPAFPPTFKFREGTSEY---------DLKRRPAWTDRIMYAVQPLNRQPG 311
            .....|: |:..||.:..|.||:|:...:..|         :.||.|||.|||::....|     
plant   306 EIMNGQI-FRGWQEGIVKFAPTYKYVPNSDLYYGCITYKKDEKKRAPAWCDRIIWYGNGL----- 364

  Fly   312 MQLSIEQCSYKSHPLYT-----ISDHKPVTSDFTIKLYPNVRAPGV---VFSPLSLWKIGDENTV 368
                      |.|. ||     ||||:||.:.||.::....|...:   .||.....:|||.::.
plant   365 ----------KQHE-YTRGETKISDHRPVKAIFTTEITVTRRGKKIRNFFFSDRFEERIGDIDSK 418

  Fly   369 EY 370
            :|
plant   419 DY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 104/352 (30%)
AT2G01900NP_001323555.1 EEP 3..392 CDD:412407 107/362 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.