DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and inpp5e

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001096089.2 Gene:inpp5e / 606579 ZFINID:ZDB-GENE-050809-23 Length:635 Species:Danio rerio


Alignment Length:346 Identity:106/346 - (30%)
Similarity:151/346 - (43%) Gaps:58/346 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GKQQLETY------RVYVVTWNV-GSR-FPDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGL 80
            |.::|:.|      .:|:.|||: |.: .|.|        |.|:.:..||.    ...|:|.:|:
Zfish   276 GAEELDRYFPERRLGIYIATWNMQGEKGLPYN--------LDDLLLPTDTD----FAQDVYVIGV 328

  Fly    81 QEVNAQPQQQVLGLFKEDPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEF 145
            ||          |......|..:.:|.|..| ||.:.......|.|::||||..:....::|...
Zfish   329 QE----------GCPDRREWEIRLQETLGPY-YVMLYAAAHGVLYLTVFVRRDLIWFCSEVEHAT 382

  Fly   146 TRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILE-----NHHYHVKR 205
            ..|........||||.:.||.:|....||.:|.|:.|..:.|||.||.:|:|     .:......
Zfish   383 VTTRIISQIKTKGAVGIGFTFFGTSFLFVTSHFTSGDSKVYERILDYNKIIEALALPRNLPDTNP 447

  Fly   206 YREIYD-----HDYVFWFGDLNFRLQGSDSSTEVRELVRDES---QHEALIQRDQLYQVREKSQL 262
            ||....     .|.||||||.||||..:....|.   :.::.   ....|:|.|||.:..::..:
Zfish   448 YRSTTSDVTTRFDEVFWFGDFNFRLNKARGDVEA---ILNQGVGVDMSPLLQHDQLTREMKEGSI 509

  Fly   263 AFQVLQERLPAFPPTFKFREGTSEYDL---KRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSH 324
             |:..||....||||:||..|...||.   :|.|::||||:|.    |||..   .|....|.|.
Zfish   510 -FKGFQEASIHFPPTYKFDIGCDVYDTTTKQRTPSYTDRILYR----NRQAD---DIRVIKYTSC 566

  Fly   325 PLYTISDHKPVTSDFTIKLYP 345
            .....|||:||...|.:||.|
Zfish   567 SSIKTSDHRPVIGMFQVKLRP 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 101/333 (30%)
inpp5eNP_001096089.2 INPP5c_INPP5E-like 285..583 CDD:197329 100/331 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.