DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and inpp5f

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_005156933.1 Gene:inpp5f / 570007 ZFINID:ZDB-GENE-041111-194 Length:1126 Species:Danio rerio


Alignment Length:310 Identity:59/310 - (19%)
Similarity:105/310 - (33%) Gaps:93/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 EDYKQILE-----NHHYHVKRYREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHE---- 245
            ||..|.||     .||:.:.:...|                  :.|..|.:.|::..||.:    
Zfish    96 EDEPQDLELELCKKHHFGINKPERI------------------TQSPDETKFLMKTLSQIKSNVG 142

  Fly   246 ALIQRD-----QLYQVREKSQLAFQVLQERLPAFPPTFKFREGTSEYDLKRRPAWTDRIMYAVQP 305
            |.|::.     |:.:.:||.:|..::|.|....|..:..|....: |||             ...
Zfish   143 APIKKKYSPAFQVKENKEKERLERRLLDELYKIFMDSDSFYYSLT-YDL-------------TNT 193

  Fly   306 LNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFTIKLYPNVRAPGVVFSPLSLWKIG------- 363
            :.||..:..|       ..||:...|.:...:...||...:::||.|.|     |.|.       
Zfish   194 VQRQGELGKS-------DQPLWKRVDDRFFWNKHMIKDLVDLQAPQVDF-----WVIPIIQGFVQ 246

  Fly   364 -DENTVEYHKQAEFDEGSNDWIGIFPSEYASLADYVAYEYVNQAESPSSSDSNHQPDPFETPSHH 427
             :|..|.|::.::.:..|.:                     ...:.|:..|..|  ..|......
Zfish   247 VEELVVNYNESSDEERSSPE---------------------TPLQEPTCVDDIH--PRFTVALIS 288

  Fly   428 RRGRHHHRNRQRQRRHQEANAQELVRLDFADDVELRHGEQYLLIYFRSTG 477
            ||.||....|.: ||..:.:...   .::.:..:|.|...:.|.:.::.|
Zfish   289 RRSRHRAGMRYK-RRGVDTDGHV---ANYVETEQLIHVHSHTLSFVQTRG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 32/164 (20%)
inpp5fXP_005156933.1 Syja_N 50..421 CDD:280532 59/310 (19%)
COG5329 65..574 CDD:227637 59/310 (19%)
hSac2 602..703 CDD:289241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.