DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and CG6805

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster


Alignment Length:311 Identity:159/311 - (51%)
Similarity:220/311 - (70%) Gaps:10/311 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQVLGLFKE 97
            ::::|||||:..|.|..|..||.|...|...|.:     |||||.:|.|||:..|  |||.:|.:
  Fly    12 IFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQ-----LPDIYVIGFQEVSTTP--QVLKIFND 69

  Fly    98 DPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSV 162
            |||..|..:.|.::.:|.|.::|:||:|::||.:.:|:.|:::||.|.||||.||:||||||||:
  Fly    70 DPWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSI 134

  Fly   163 RFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHVKRYREIYDHDYVFWFGDLNFRLQG 227
            |.:|||.|:|||.:||.|||..:.||||||.||::||.|:.:.||.|:|||:|||||||||||.|
  Fly   135 RLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDFVFWFGDLNFRLSG 199

  Fly   228 SDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREGTSEYDLKRR 292
            ..|:.:||..|.:: ::..|::.|||..:|||.. ||.:|:|:.|.|.|||||.|||::|:||||
  Fly   200 DMSAWDVRTDVENQ-RYADLLKLDQLNLLREKGN-AFSLLEEQQPNFAPTFKFVEGTNDYNLKRR 262

  Fly   293 PAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFTIKL 343
            |||.|||::.||. |..||:.||..|.||:||..||:||||||::.|..|:
  Fly   263 PAWCDRILHRVQS-NIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 158/307 (51%)
CG6805NP_611178.1 EEP 12..308 CDD:294334 157/305 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443103
Domainoid 1 1.000 208 1.000 Domainoid score I2804
eggNOG 1 0.900 - - E1_COG5411
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105940at6656
OrthoFinder 1 1.000 - - FOG0001973
OrthoInspector 1 1.000 - - mtm6451
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11200
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1469
109.900

Return to query results.
Submit another query.