DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and Inpp5a

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_006230548.1 Gene:Inpp5a / 365382 RGDID:1306168 Length:422 Species:Rattus norvegicus


Alignment Length:453 Identity:98/453 - (21%)
Similarity:146/453 - (32%) Gaps:183/453 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GKQQLETYRVYVVTWNVGSRF--PDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEV--- 83
            ||.......|.:||.||||.|  |:|:....|.....|        .:.|.|...||..||.   
  Rat     3 GKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQV--------LHTHKPHFMALHCQEFGGK 59

  Fly    84 ----------------------------------NAQPQQQ--VLGLFKEDPWTHKAKELLRNYD 112
                                              |.:.|:.  .||.|.   :.|::.:.:..:|
  Rat    60 NYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFY---FLHESLKNIYQFD 121

  Fly   113 YVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAE-FTRTGFGGI-WGNKGAVSVRFTLYGCGLAFVV 175
            :.|.|.:::.|    ..:....:|....:|.| |.:..|... |..||.:..|:.:..|....|.
  Rat   122 FKAKKYKKVTG----KEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVN 182

  Fly   176 AHL-------------------TAH-------DHMMDERIEDYKQILENHHYHVKRYREIYDHDY 214
            .||                   ..|       |.::|:|.|...                     
  Rat   183 IHLFHDASNLVAWETSPSVYSGVRHKALGYVLDRIIDQRFEKVS--------------------- 226

  Fly   215 VFWFGDLNFRLQGSD-----------------SSTEVRELVRDESQHEALIQRDQLYQVREK--- 259
            .|.|||.||||....                 .:.||.:|:..||.::    |..:.|:.:|   
  Rat   227 YFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDND----RKVVLQLEKKLFD 287

  Fly   260 --SQLAFQ---------------VLQERL----PAFPPTFKFREGTS---EYDLKRRPAWTDRIM 300
              :|..|:               |.::||    .:|||::.:.|.:|   :|...|.|||.|||:
  Rat   288 YFNQDVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDSSQGEQYMNTRCPAWCDRIL 352

  Fly   301 YAVQPLNRQPGMQLSIEQCSYKSH------------PLYTISDHKPVTSDFTIKLYPNVRAPG 351
                       |.||.::...||.            |...:.|||||...|.|       |||
  Rat   353 -----------MSLSAKELVLKSESEEKVATYDHIGPNVCMGDHKPVFLAFRI-------APG 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 92/434 (21%)
Inpp5aXP_006230548.1 INPP5A 10..394 CDD:197326 92/434 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.