DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and INPPL1

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_024304269.1 Gene:INPPL1 / 3636 HGNCID:6080 Length:1324 Species:Homo sapiens


Alignment Length:492 Identity:123/492 - (25%)
Similarity:191/492 - (38%) Gaps:152/492 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KGKGKQQLE--TYRVYVVTWNVGS-RFPDNIS---LRHLLG--LQDVTVDKDTKETNAHLPDIYA 77
            |.|..:|.|  ...|::.|||:|| ..|.|::   ....||  |.:|||      |..|  |||.
Human   434 KNKHSKQDEPDMISVFIGTWNMGSVPPPKNVTSWFTSKGLGKTLDEVTV------TIPH--DIYV 490

  Fly    78 LGLQEVNAQPQQQVLGLFKEDPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIE 142
            .|.|| |:...::.|.|.:..     .|| |.:.||..:..:.:..:.:::.|:.:|...:..:.
Human   491 FGTQE-NSVGDREWLDLLRGG-----LKE-LTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVS 548

  Fly   143 AEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHVKRYR 207
            ....:||.....||||||.|.|...|....||..|||:.:.....|.::|..||        |..
Human   549 TSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVNCHLTSGNEKTARRNQNYLDIL--------RLL 605

  Fly   208 EIYDHD-----------YVFWFGDLNFRLQGSDSSTEVRELVR--DESQHEALIQRDQLYQVREK 259
            .:.|..           ::|||||||:||     ..:::|::.  ...:.|.|::.|||...|||
Human   606 SLGDRQLNAFDISLRFTHLFWFGDLNYRL-----DMDIQEILNYISRKEFEPLLRVDQLNLEREK 665

  Fly   260 SQLAFQVLQERLPAFPPTFKFREGTSE-YDLKRR---------PAWTDRIMYAVQP--------- 305
            .::..:..:|.: :||||:::..|:.: |...::         |:|.|||::...|         
Human   666 HKVFLRFSEEEI-SFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSY 729

  Fly   306 ----------------------LNR-QPGMQLSIEQCSYKSHPL-------YTISDHKPVTSDFT 340
                                  |.| :|  ::.|...|..|:||       ...|||.||...|.
Human   730 GQSLPDRVMGDLGWSPSGLCPNLGRWEP--RVGIFPLSPHSYPLSPGCTDDIVTSDHSPVFGTFE 792

  Fly   341 IKLYPNVRAPGVV---FSPLSLWKIGDENTV---------------------------EYHKQAE 375
            :         ||.   .|...|.|..|:..:                           ||.|..|
Human   793 V---------GVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCLEEYKKSFE 848

  Fly   376 FDEGSNDWIGIFPSEYAS---------LADYVAYEYV 403
            .|..|:|.|.....:::|         |||   .||:
Human   849 NDAQSSDNINFLKVQWSSRQLPTLKPILAD---IEYL 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 99/377 (26%)
INPPL1XP_024304269.1 SH2_SHIP 17..119 CDD:198206
EEP 446..793 CDD:321002 99/377 (26%)
Atrophin-1 <965..1280 CDD:331285
SAM_Ship2 1260..1322 CDD:188890
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.