DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and FIG4

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_608841.1 Gene:FIG4 / 33658 FlyBaseID:FBgn0031611 Length:858 Species:Drosophila melanogaster


Alignment Length:354 Identity:73/354 - (20%)
Similarity:124/354 - (35%) Gaps:101/354 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 VRFTLYGCGLAFVV-----AHLTAHDHMMDERIEDYKQILENH-------HYHVKRYREIYDH-- 212
            ||| |.|..|..|.     ||:..|   :...|:|...:..|.       |.|..||:.::.:  
  Fly    91 VRF-LEGYYLLLVTKRKCCAHIGRH---LVYTIKDTVMVRVNEVTSQRPPHPHEDRYKRMFQNID 151

  Fly   213 ---DYVFWFG-DLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQERLPA 273
               ::.|.:. ||...||.::|:........|..:.|.|...:.|....:|:       .||:  
  Fly   152 LRSNFYFSYSYDLTRTLQYNESAPRYVGAKVDLDRDEPLPDWNTLTSNVDKA-------HERV-- 207

  Fly   274 FPPTFKFREGTSEYDLKRRPAWTDRIMYAVQPLNRQPGMQLS---IEQCSYKSHPLYTISDHKPV 335
               .:.||.     |.::|..|.   .|.:||:.   |:.|.   :|                 |
  Fly   208 ---DYAFRS-----DSRKRFVWN---AYLLQPME---GIMLKDWLLE-----------------V 241

  Fly   336 TSDFT----IKLYPN------VRAPGVVFSPLSLWKIGDENTVEYHKQAEFDEGSNDW--IGIFP 388
            |..|.    |.::..      |......|:.....|.|.....:...:.|.::..:|.  |..|.
  Fly   242 THGFVSQSCISIFGRHVNVCLVARRSSRFAGTRFLKRGANFQGDVANEVETEQIVSDGQRICAFT 306

  Fly   389 SEYASLADYVAYEYVNQAESPS-SSDSNHQPDPF-ETPS-HHRRGRHHH----------RNRQRQ 440
            ....|:..:.:.:.......|. ..|.   .||: :||| |..|...|:          :.|:| 
  Fly   307 QMRGSIPSHWSQDISKMVPKPQIQLDI---CDPYAQTPSLHFERLLFHYGAPLIMLNLVKKRER- 367

  Fly   441 RRHQEANAQELVRLDFADDVELRHGEQYL 469
            |:|:...::||       :..:|:..|:|
  Fly   368 RKHESIISKEL-------EYSIRYLNQFL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 44/203 (22%)
FIG4NP_608841.1 COG5329 19..599 CDD:227637 73/354 (21%)
Syja_N 85..407 CDD:280532 73/354 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.