DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and inppl1a

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001034893.1 Gene:inppl1a / 325179 ZFINID:ZDB-GENE-030131-3904 Length:1266 Species:Danio rerio


Alignment Length:344 Identity:83/344 - (24%)
Similarity:153/344 - (44%) Gaps:51/344 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SKGKGKQQLETYRVYVVTWNVGSRFPDNISLRHLLG--LQDVTVDKDTKETNAHLP-DIYALGLQ 81
            :|...:.:.:...:::.|||:||     :.....||  :....:.|...|....:| |||..|.|
Zfish   397 NKHSNQDEPDMISIFIGTWNMGS-----VPAPKPLGSWILSRGLGKTLDEMAVTIPHDIYVFGTQ 456

  Fly    82 EVNAQPQQQVLGLFKEDPWTHKAKELLRNY---DYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEA 143
            |.:...::          |....:..|:.|   :|..:..:.:..:.:.:.|:.:|...:..:..
Zfish   457 ENSVCDKE----------WVETLRCSLKEYTDMEYKPIAVQTLWNIKIVVLVKAEHENRISHVGM 511

  Fly   144 EFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHVKRYRE 208
            ...:||.....||||||.|.|...|....||..|||:.:..:..|.::|..||.......|:...
Zfish   512 SSVKTGIANTLGNKGAVGVSFMFNGTSFGFVNCHLTSGNEKIHRRNQNYLDILRQLSLGDKQLNS 576

  Fly   209 IYD----HDYVFWFGDLNFRLQGSDSSTEVRELVR--DESQHEALIQRDQLYQVREKSQLAFQVL 267
             :|    ..::|||||||:||     ..:::|::.  :..:.:.|::.|||...|||:::..:..
Zfish   577 -FDISLRFTHLFWFGDLNYRL-----DMDIQEILNYINRKEFDPLLKVDQLNLEREKNKIFLRFA 635

  Fly   268 QERLPAFPPTFKFREGTSE-YDLKRR---------PAWTDRIMYAVQPLNRQPGMQLSIEQCSYK 322
            :|.: ::|||:::..|:.: |..:::         |:|.|||::...|       :..|...||.
Zfish   636 EEEI-SYPPTYRYERGSRDTYVWQKQKATGMRTNVPSWCDRILWKSYP-------ETHIVCNSYG 692

  Fly   323 SHPLYTISDHKPVTSDFTI 341
            .......|||.||...|.:
Zfish   693 CTDDIVTSDHSPVFGTFEV 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 82/331 (25%)
inppl1aNP_001034893.1 SH2_SHIP 15..113 CDD:198206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..159
INPP5c_SHIP2-INPPL1 408..711 CDD:197335 82/331 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 879..951
NPXY motif 958..961
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 986..1132
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1147..1174
SAM_Ship2 1204..1263 CDD:188890
SAM 1207..1263 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.