DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and Inpp5f

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001101024.2 Gene:Inpp5f / 309008 RGDID:1305777 Length:1130 Species:Rattus norvegicus


Alignment Length:223 Identity:41/223 - (18%)
Similarity:75/223 - (33%) Gaps:76/223 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LQEVNAQPQQQVLGL----FKEDPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQD 140
            |:::...|.:|.|.:    ..:..|.:....:.|.|...|.                        
  Rat   480 LKKLGVMPPEQPLPVKCNRTYQIMWANNGDSISRQYAGTAA------------------------ 520

  Fly   141 IEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHVKR 205
            ::.:|||||...:.|                            :|.:.:.      ..:.|::.|
  Rat   521 LKGDFTRTGERKLAG----------------------------VMKDGVN------SANRYYLSR 551

  Fly   206 YREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQER 270
            :::.|....:    ||   :||...:.::..:...|.:||||.:..|    |...:|..|:||..
  Rat   552 FKDAYRQAVI----DL---MQGIPVTEDLYSIFTKEKEHEALQKETQ----RSHQELISQLLQSY 605

  Fly   271 LP-AFPPTFKFREGTSEYDLKRRPAWTD 297
            :. ..|...||..|.:..|..  |:.||
  Rat   606 MQLLLPGDEKFHGGWALIDCD--PSLTD 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 41/223 (18%)
Inpp5fNP_001101024.2 Syja_N 50..414 CDD:280532
hSac2 594..695 CDD:289241 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339870
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.