DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and Sh2d1b1

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_036139.3 Gene:Sh2d1b1 / 26904 MGIID:1349420 Length:132 Species:Mus musculus


Alignment Length:44 Identity:14/44 - (31%)
Similarity:21/44 - (47%) Gaps:5/44 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ETNAHLPDIYALGLQEVNAQPQQQVLGLFKEDPWTHKAKELLRN 110
            |||||.|......|||:.::..:...||.     .|.:..::||
Mouse    66 ETNAHTPRTIFPNLQELVSKYGKPGQGLV-----VHLSNPIMRN 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 14/44 (32%)
Sh2d1b1NP_036139.3 SH2_SAP1 1..103 CDD:198205 12/41 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.