DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and INPP5F

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_055752.1 Gene:INPP5F / 22876 HGNCID:17054 Length:1132 Species:Homo sapiens


Alignment Length:214 Identity:38/214 - (17%)
Similarity:72/214 - (33%) Gaps:74/214 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LQEVNAQPQQQVLGL----FKEDPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQD 140
            |:::...|.:|.|.:    ..:..|.:....:.|.|...|.                        
Human   481 LKKLGVMPPEQPLPVKCNRIYQIMWANNGDSISRQYAGTAA------------------------ 521

  Fly   141 IEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHVKR 205
            ::.:|||||...:.|                            :|.:.:.      ..:.|::.|
Human   522 LKGDFTRTGERKLAG----------------------------VMKDGVN------SANRYYLNR 552

  Fly   206 YREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQER 270
            :::.|....:    ||   :||...:.::..:...|.:||||.:.:|    |...:|..|:||..
Human   553 FKDAYRQAVI----DL---MQGIPVTEDLYSIFTKEKEHEALHKENQ----RSHQELISQLLQSY 606

  Fly   271 LP-AFPPTFKFREGTSEYD 288
            :. ..|...||..|.:..|
Human   607 MKLLLPDDEKFHGGWALID 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 38/214 (18%)
INPP5FNP_055752.1 Syja_N 50..415 CDD:280532
hSac2 595..697 CDD:289241 9/31 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 846..875
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 923..942
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 974..1017
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.