DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9784 and Inpp5e

DIOPT Version :9

Sequence 1:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_446084.1 Gene:Inpp5e / 114089 RGDID:620478 Length:648 Species:Rattus norvegicus


Alignment Length:367 Identity:100/367 - (27%)
Similarity:155/367 - (42%) Gaps:65/367 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GKQQLETY------RVYVVTWNVGSRFPDNISLRHLLGLQDV--TVDKDTKETNA-HLPDIYALG 79
            |..:|..|      .::|.|||             :.|.:::  ::|:....|.| :..|:|.:|
  Rat   290 GADELARYFPDRNMALFVATWN-------------MQGQKELPASLDEFLLPTEADYTQDLYVIG 341

  Fly    80 LQEVNAQPQQQVLGLFKEDPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAE 144
            :||          |......|..:.:|.| ...||.:.:.....|.:|:|:||..:....::|..
  Rat   342 VQE----------GCSDRREWETRLQETL-GPQYVLLSSAAHGVLYMSLFIRRDLIWFCSEVEYS 395

  Fly   145 FTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDY----------KQILENH 199
            ...|........|||:.|.||.:|....|:.:|.|:.|..:.||:.||          :.:.:.:
  Rat   396 TVTTRIVSQIKTKGALGVSFTFFGTSFLFITSHFTSGDGKVAERLLDYNRTIQALALPRNVPDTN 460

  Fly   200 HYHVKRYREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAF 264
            .|...........|.||||||.||||.|...:.|.......|....||:|.|||.:..:|..: |
  Rat   461 PYRSSAGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQDPEVDVLALLQHDQLTREMKKGSI-F 524

  Fly   265 QVLQERLPAFPPTFKFREGTSEYD---LKRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPL 326
            :..:|....|.|::||..|...||   .:|.|::|||::|.    :|..|   .|....|.|.|.
  Rat   525 KGFEEAEIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLYK----SRHKG---DICPMKYSSCPG 582

  Fly   327 YTISDHKPVTSDFTIKLYP---NVRAPGVVFSPLSLWKIGDE 365
            ...|||:||...|.:|:.|   |:        ||:..|...|
  Rat   583 IKTSDHRPVYGLFRVKVRPGRDNI--------PLAAGKFDRE 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 91/331 (27%)
Inpp5eNP_446084.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
4 X 4 AA repeats of P-X-X-P 59..243
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..158
INPP5c_INPP5E-like 299..597 CDD:197329 90/329 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.