DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG17949 and LOC684444

DIOPT Version :9

Sequence 1:NP_724342.1 Gene:His2B:CG17949 / 326273 FlyBaseID:FBgn0061209 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_003749220.1 Gene:LOC684444 / 684444 RGDID:1590323 Length:123 Species:Rattus norvegicus


Alignment Length:89 Identity:46/89 - (51%)
Similarity:64/89 - (71%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRL 98
            :|::||.:|||:|.|..||||..:.|||..:||||||||.||.:..:..||.|:||.:||.||.:
  Rat    35 NYSLYINRVLKEVVPKRGISSHTVDIMNLMINDIFERIATEACQRMNLRKRCTLTSEDIQKAVYM 99

  Fly    99 LLPGELAKHAVSEGTKAVTKYTSS 122
            |:|.:|||.||:.|:|||.::..|
  Rat   100 LMPKKLAKLAVTFGSKAVHRFIHS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG17949NP_724342.1 H2B 33..121 CDD:197718 45/86 (52%)
LOC684444XP_003749220.1 H2B <36..120 CDD:304987 45/83 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1536672at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.