DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG17949 and H2BW2

DIOPT Version :9

Sequence 1:NP_724342.1 Gene:His2B:CG17949 / 326273 FlyBaseID:FBgn0061209 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_011529224.1 Gene:H2BW2 / 286436 HGNCID:27867 Length:154 Species:Homo sapiens


Alignment Length:135 Identity:55/135 - (40%)
Similarity:83/135 - (61%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTSGKAAKKAGKA-----QKNITKTDKKKKR-----KRK----------ESYAIYIYKVLKQVHP 48
            :.|.:...:.|::     :.|.||..|:|:|     :|:          :|:..|..:||||||.
Human     9 EASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSFTPYFPRVLKQVHQ 73

  Fly    49 DTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGT 113
            ...:|.:|:|:|:|.::||.:|||.||.:||||.||.|||||:||.||||||||::.|.|.::||
Human    74 GLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMAVRLLLPGKMGKLAEAQGT 138

  Fly   114 KAVTK 118
            .|..:
Human   139 NAALR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG17949NP_724342.1 H2B 33..121 CDD:197718 46/86 (53%)
H2BW2XP_011529224.1 H2B <58..145 CDD:355063 46/86 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1536672at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.