DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG17949 and H2BU1

DIOPT Version :9

Sequence 1:NP_724342.1 Gene:His2B:CG17949 / 326273 FlyBaseID:FBgn0061209 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_778225.1 Gene:H2BU1 / 128312 HGNCID:20514 Length:126 Species:Homo sapiens


Alignment Length:128 Identity:105/128 - (82%)
Similarity:110/128 - (85%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-PKTSGKAAKKAGKAQKNITKTDKK--KKRK--RKESYAIYIYKVLKQVHPDTGISSKAMSIM 60
            || |..|..|.||..|  |.:||..||  ||||  |||||:||:||||||||||||||||||.||
Human     1 MPDPSKSAPAPKKGSK--KAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIM 63

  Fly    61 NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||||||||||||:||||||||||||||||||:|||||||||||||||||||||||||||||||
Human    64 NSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG17949NP_724342.1 H2B 33..121 CDD:197718 82/87 (94%)
H2BU1NP_778225.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 17/35 (49%)
H2B 36..124 CDD:197718 82/87 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4650
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3871
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 1 1.010 - - D1536672at2759
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm40568
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.