DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG17949 and LOC108179079

DIOPT Version :9

Sequence 1:NP_724342.1 Gene:His2B:CG17949 / 326273 FlyBaseID:FBgn0061209 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_017209712.1 Gene:LOC108179079 / 108179079 -ID:- Length:124 Species:Danio rerio


Alignment Length:125 Identity:102/125 - (81%)
Similarity:108/125 - (86%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PKTSGKAAKKAGKAQKNITKTD----KKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSF 63
            |:.:..|.||..|  |.:|||.    ||::|.||||||||:||||||||||||||||||.|||||
Zfish     2 PEPAKTAPKKGSK--KAVTKTSGKSGKKRRRSRKESYAIYVYKVLKQVHPDTGISSKAMGIMNSF 64

  Fly    64 VNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish    65 VNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG17949NP_724342.1 H2B 33..121 CDD:197718 84/87 (97%)
LOC108179079XP_017209712.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1536672at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.