DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG17949 and LOC100498553

DIOPT Version :9

Sequence 1:NP_724342.1 Gene:His2B:CG17949 / 326273 FlyBaseID:FBgn0061209 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_002942903.3 Gene:LOC100498553 / 100498553 -ID:- Length:126 Species:Xenopus tropicalis


Alignment Length:128 Identity:107/128 - (83%)
Similarity:112/128 - (87%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-PKTSGKAAKKAGKAQKNITKTDK---KKKRK-RKESYAIYIYKVLKQVHPDTGISSKAMSIM 60
            || |..|..||||..|  |.:|||.|   ||:|| ||||||||:|||||||||||||||||||||
 Frog     1 MPDPVKSAPAAKKGSK--KAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIM 63

  Fly    61 NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||||||:|||||.||||||||||||||||||||||||||||||||||||||||||||||||:|
 Frog    64 NSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG17949NP_724342.1 H2B 33..121 CDD:197718 84/87 (97%)
LOC100498553XP_002942903.3 H2B 28..124 CDD:197718 90/95 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4606
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H128594
Inparanoid 1 1.050 193 1.000 Inparanoid score I3729
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1536672at2759
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm47745
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.