DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MtnD and MtnC

DIOPT Version :10

Sequence 1:NP_788695.2 Gene:MtnD / 326270 FlyBaseID:FBgn0053192 Length:44 Species:Drosophila melanogaster
Sequence 2:NP_650882.1 Gene:MtnC / 42416 FlyBaseID:FBgn0038790 Length:43 Species:Drosophila melanogaster


Alignment Length:43 Identity:31/43 - (72%)
Similarity:36/43 - (83%) Gaps:0/43 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCKACGTNCQCSATKCGDNCACSQQCQCSCKNGPKDKCCSTK 43
            |.||.|||||:|..|||||||||:|.|:|.|||||||:||.:|
  Fly     1 MVCKGCGTNCKCQDTKCGDNCACNQDCKCVCKNGPKDQCCKSK 43

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtnDNP_788695.2 Metallothio_5 1..41 CDD:280273 29/39 (74%)
MtnCNP_650882.1 Metallothio_5 1..41 CDD:280273 29/39 (74%)

Return to query results.
Submit another query.