DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMC3 and C44C10.10

DIOPT Version :10

Sequence 1:NP_523374.2 Gene:SMC3 / 32627 FlyBaseID:FBgn0015615 Length:1200 Species:Drosophila melanogaster
Sequence 2:NP_509954.1 Gene:C44C10.10 / 183458 WormBaseID:WBGene00008090 Length:127 Species:Caenorhabditis elegans


Alignment Length:55 Identity:18/55 - (32%)
Similarity:24/55 - (43%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IIIQGFKSYKDQTVVEPFDKRHNVVVGRNGSGKSNFFYAIQFVLSDEFTHLRPEQ 60
            |.::.|...:| ...|.|.| ...:.|.||.|||....||..:..||.|....:|
 Worm    54 ISVKNFMCLED-VKYESFGK-ITTITGPNGCGKSALVRAIGILTGDEVTESSNQQ 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMC3NP_523374.2 SMC_N 2..1180 CDD:426784 18/55 (33%)
C44C10.10NP_509954.1 COG3950 50..>126 CDD:443150 18/55 (33%)

Return to query results.
Submit another query.