powered by:
Protein Alignment SMC3 and C44C10.10
DIOPT Version :9
Sequence 1: | NP_523374.2 |
Gene: | SMC3 / 32627 |
FlyBaseID: | FBgn0015615 |
Length: | 1200 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509954.1 |
Gene: | C44C10.10 / 183458 |
WormBaseID: | WBGene00008090 |
Length: | 127 |
Species: | Caenorhabditis elegans |
Alignment Length: | 55 |
Identity: | 18/55 - (32%) |
Similarity: | 24/55 - (43%) |
Gaps: | 2/55 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 IIIQGFKSYKDQTVVEPFDKRHNVVVGRNGSGKSNFFYAIQFVLSDEFTHLRPEQ 60
|.::.|...:| ...|.|.| ...:.|.||.|||....||..:..||.|....:|
Worm 54 ISVKNFMCLED-VKYESFGK-ITTITGPNGCGKSALVRAIGILTGDEVTESSNQQ 106
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1196 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.