DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMC3 and C44C10.10

DIOPT Version :9

Sequence 1:NP_523374.2 Gene:SMC3 / 32627 FlyBaseID:FBgn0015615 Length:1200 Species:Drosophila melanogaster
Sequence 2:NP_509954.1 Gene:C44C10.10 / 183458 WormBaseID:WBGene00008090 Length:127 Species:Caenorhabditis elegans


Alignment Length:55 Identity:18/55 - (32%)
Similarity:24/55 - (43%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IIIQGFKSYKDQTVVEPFDKRHNVVVGRNGSGKSNFFYAIQFVLSDEFTHLRPEQ 60
            |.::.|...:| ...|.|.| ...:.|.||.|||....||..:..||.|....:|
 Worm    54 ISVKNFMCLED-VKYESFGK-ITTITGPNGCGKSALVRAIGILTGDEVTESSNQQ 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMC3NP_523374.2 SMC_N 2..1180 CDD:280601 18/55 (33%)
ABC_SMC3_euk 3..>159 CDD:213239 18/55 (33%)
SMC_hinge 533..643 CDD:214944
TMPIT 678..>760 CDD:285135
CHD5 <780..>822 CDD:282299
P-loop_NTPase <1088..1182 CDD:304359
C44C10.10NP_509954.1 AAA_23 54..>117 CDD:379210 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.