DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Prss55

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:274 Identity:80/274 - (29%)
Similarity:122/274 - (44%) Gaps:30/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IARCLTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSE-ELCGGSLVKP 65
            |..|:.:..|:.|......|....||.....|||.|..:.:.|..:.|.:..|: ..||||::..
Mouse    29 IRDCILTECLLCIASSECGVRPLYDSRIQYSRIIEGQEAELGEFPWQVSIQESDHHFCGGSILSE 93

  Fly    66 RWVITAAHCVYNK--NKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSD 128
            .|::|.|||.|.:  :..|.::..| :|......|...|..|.....|.|..::.|:|.|.| :.
Mouse    94 WWILTVAHCFYAQELSPTDLRVRVG-TNDLTTSPVELEVTTIIRHKGFKRLNMDNDIALLLL-AK 156

  Fly   129 MIGANIETIPLAAQSVPARAL---VKVSGWGFLTADATKTAERVHSVLVPM----WSRASCVSAF 186
            .:..|..|:|:.....||...   ..|:||| :|....|.:.....:.|||    |.  .|:..|
Mouse   157 PLTFNELTVPICLPLWPAPPSWHECWVAGWG-VTNSTDKESMSTDLMKVPMRIIEWE--ECLQMF 218

  Fly   187 RGIHRITRSMVCAARLY---KKDSCDGDSGGPLV------YRGQLAGIVSFGYGCA-SALPGIYT 241
            ..   :|.:|:||:  |   ..|:|.||||||||      .|....||:|:|..|. ...|||||
Mouse   219 PS---LTTNMLCAS--YGNESYDACQGDSGGPLVCTTDPGSRWYQVGIISWGKSCGKKGFPGIYT 278

  Fly   242 SVPEIRDWFQRVVE 255
            .:.:...|.:::.:
Mouse   279 VLAKYTLWIEKIAQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 72/235 (31%)
Tryp_SPc 34..253 CDD:238113 72/238 (30%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.