DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and prss1

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:254 Identity:78/254 - (30%)
Similarity:127/254 - (50%) Gaps:22/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILGFHSAVYAHP--DSVQIQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVY 76
            :|...:..||.|  |.   ..:|:||:..:.....|.|.:.:....|||||:...||::||||..
Zfish     6 LLALFAVAYAAPLGDD---DDKIVGGYECTKNGVPYQVSLNSGYHFCGGSLISNLWVVSAAHCYK 67

  Fly    77 NK-----NKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSD-MIGANIE 135
            ::     .:::..:..|.........|||       .|.:|..||:.||..::|:|. .|.:.::
Zfish    68 SRVQVRLGEHNIDVTEGTEQFINSEKVIR-------HPSYNSNTLDNDVMLIKLSSSAQINSYVK 125

  Fly   136 TIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAA 200
            |:.|.:....:.....:||||.::|..:....|:..:..|:.|.::|.:|:.|  :|:.:|.||.
Zfish   126 TVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNAYPG--QISSNMFCAG 188

  Fly   201 RLY-KKDSCDGDSGGPLVYRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVEQH 257
            .:. .||||.||||||:|...||.||||:|||||.. .||:|..|.....|.:..:..:
Zfish   189 FMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWIRNTMNSN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 72/223 (32%)
Tryp_SPc 34..253 CDD:238113 73/226 (32%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 72/224 (32%)
Tryp_SPc 25..243 CDD:238113 73/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.