DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG17239

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:238 Identity:73/238 - (30%)
Similarity:117/238 - (49%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IQPRIIGGHVSSIKEEKYLVQVTTSEEL-CGGSLVKPRWVITAAHCVYNKNK--------NDFKI 85
            |..||:||.:.:|....:...:...... ||.::.....|||||||:.::..        :.|..
  Fly    20 IPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTF 84

  Fly    86 YGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGANIETIPLAAQSVPARAL 149
            :||        .|:| |..:.:..::::...| |:|.:||.|.: :|:.:..||||.....:.:.
  Fly    85 FGG--------QVVR-VSSVLLHEEYDQSWSN-DIAVMRLQSKLRLGSAVSVIPLADTPPASGSP 139

  Fly   150 VKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGG 214
            ..|||||.:......... :.|..|.:..:..|..::.  .:||:.|:||| ...||:|.|||||
  Fly   140 ATVSGWGAIGFKKNYPMS-ILSASVDIVDQDQCRRSYG--RKITKDMICAA-APGKDACSGDSGG 200

  Fly   215 PLVYRGQLAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVEQ 256
            |||...:|.||||||..|| ...||:|.:|.|::.|....:|:
  Fly   201 PLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIER 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 70/226 (31%)
Tryp_SPc 34..253 CDD:238113 70/229 (31%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 70/227 (31%)
Tryp_SPc 24..237 CDD:238113 69/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.